DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Lcp65Ag3

DIOPT Version :10

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:190 Identity:41/190 - (21%)
Similarity:61/190 - (32%) Gaps:72/190 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 AGNAFSDDVADCAVGLLISVLRRIPAADRYVRSGNWAKFGDFQLGSKVSGKRVGIVGLGS--IGS 165
            |..:|..|:.|......:.....|...:..|..|.|    :||:|..     |||.....  |..
  Fly   172 ADKSFGRDIVDAHYKASLYAGINISGINGEVMPGQW----EFQVGPS-----VGISAADEIWIAR 227

  Fly   166 FVAKRL-ESFGCVIS------------------YNSRSQKQSSPY------------RYYSDILS 199
            ::.:|: |..|.|:|                  |:::|.::...|            |:...|.:
  Fly   228 YILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIEKLGLRHKEHISA 292

  Fly   200 LAENNDVLVLCCSLTDETHH-----------IVNREVMELLGKDGVVINVGRGKLIDEKE 248
            ..|.|:     ..||.  ||           :.||         |..|.|||.   .|||
  Fly   293 YGEGNE-----RRLTG--HHETADINTFLWGVANR---------GASIRVGRD---TEKE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.