DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Lcp65Ag3

DIOPT Version :8

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster

Alignment Length:104 Identity:66/104 - (63%)
Similarity:84/104 - (80%) Gaps:5/104 - (4%)


  Fly     1 MKFLIVFVALFALAVA-----DVQILKQESDVGPVSFNYGYETSDGSSAQAAGQLKNVGTDEEAL 60
            ||||||||||||:|:|     :..|::.||||||.||.|.:|||||.:|||.|||.::||:.||:
  Fly     1 MKFLIVFVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENEAI 65

  Fly    61 NVKGTYSFVADDGQTYSIAYTADENGYQPQGAHLPVAPV 99
            :|.|:|.|:|||||||.:.|.||:||:||:|||||||||
  Fly    66 SVSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLPVAPV 104

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:278791 32/54 (59%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:278791 32/54 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131274731
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.