DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Cpr65Az

DIOPT Version :8

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster

Alignment Length:86 Identity:39/86 - (45%)
Similarity:54/86 - (62%) Gaps:2/86 - (2%)


  Fly    17 DVQILKQESDVG-PVSFNYGYETSDGSSAQAAGQLKNVGTD-EEALNVKGTYSFVADDGQTYSIA 79
            |:.|:|.||.|. ..|:.|.|||.:|..|:..|.|||.|.: .||...:|::|:.:.:||..|:.
  Fly   113 DIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLT 177

  Fly    80 YTADENGYQPQGAHLPVAPVV 100
            |.|||||:||||.|||..|.:
  Fly   178 YIADENGFQPQGDHLPTPPPI 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:278791 23/55 (42%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.