DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Lcp65Ag1

DIOPT Version :9

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster


Alignment Length:104 Identity:67/104 - (64%)
Similarity:84/104 - (80%) Gaps:5/104 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIVFVALFALAVA-----DVQILKQESDVGPVSFNYGYETSDGSSAQAAGQLKNVGTDEEAL 60
            ||||||||||||:|:|     :..|::.||||||.||.|.:|||||.:|||.|||.::||:.||:
  Fly     1 MKFLIVFVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENEAI 65

  Fly    61 NVKGTYSFVADDGQTYSIAYTADENGYQPQGAHLPVAPV 99
            :|.|:|.|:|||||||.:.|.||:||:||||||||||||
  Fly    66 SVSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLPVAPV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:278791 32/54 (59%)
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:306811 32/54 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466861
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 1 1.000 - - FOG0005922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.