DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and l(3)mbn

DIOPT Version :10

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_729143.2 Gene:l(3)mbn / 38701 FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster


Alignment Length:119 Identity:29/119 - (24%)
Similarity:41/119 - (34%) Gaps:33/119 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIVFVALFALAVADVQILKQESDVGPVSFNYGYETSDGSSAQAAGQLKNVGTDEEALNVKGTYSF 68
            |:.||....|......:|...:.|.|..|.:   |.|....:|..:      ||..: :.|.:.|
  Fly     5 LMAFVCALLLLCTLTHVLSAATTVRPYKFGF---TIDEQQHRAEKR------DERGI-IMGEFGF 59

  Fly    69 VADDGQTYSIAYTADENG-----------YQ-PQGAH-----------LPVAPV 99
            :..||..:...|..||.|           |. |.|:.           ||.|||
  Fly    60 ITADGIYHVTVYATDEEGKFRIISMKSYPYAGPVGSKSVPVTTTPKVLLPAAPV 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 14/65 (22%)
l(3)mbnNP_729143.2 Chitin_bind_4 575..621 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.