powered by:
Protein Alignment Lcp65Af and CG15756
DIOPT Version :8
Sequence 1: | NP_477274.1 |
Gene: | Lcp65Af / 45017 |
FlyBaseID: | FBgn0020639 |
Length: | 100 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_572895.1 |
Gene: | CG15756 / 32308 |
FlyBaseID: | FBgn0030493 |
Length: | 298 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 19/71 - (26%) |
Similarity: | 30/71 - (42%) |
Gaps: | 5/71 - (7%) |
Fly 32 FNYGYETSDGSSAQAAGQLKNVGTDEEALNVKGTYSFVADDGQTYSIAYTADENGY----QPQGA 92
:.:.|:..:|::.........||.| ..|..||.||....:.:..::.||||..|| |....
Fly 108 YEFRYQLDNGNTRYERAYWLPVGKD-LVLAKKGYYSVPLPNDKYSTVFYTADHRGYHVDMQTLSV 171
Fly 93 HLPVAP 98
..|:.|
Fly 172 EQPLLP 177
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
|
|
P |
PTHR10380 |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.