DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and CG15756

DIOPT Version :10

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster


Alignment Length:71 Identity:19/71 - (26%)
Similarity:30/71 - (42%) Gaps:5/71 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FNYGYETSDGSSAQAAGQLKNVGTDEEALNVKGTYSFVADDGQTYSIAYTADENGY----QPQGA 92
            :.:.|:..:|::.........||.| ..|..||.||....:.:..::.||||..||    |....
  Fly   108 YEFRYQLDNGNTRYERAYWLPVGKD-LVLAKKGYYSVPLPNDKYSTVFYTADHRGYHVDMQTLSV 171

  Fly    93 HLPVAP 98
            ..|:.|
  Fly   172 EQPLLP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 14/54 (26%)
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:459790 14/54 (26%)

Return to query results.
Submit another query.