DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Cpr49Aa

DIOPT Version :8

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster

Alignment Length:114 Identity:41/114 - (35%)
Similarity:64/114 - (56%) Gaps:14/114 - (12%)


  Fly     1 MKFLIVFVALFALAVAD-------------VQILKQESDVG-PVSFNYGYETSDGSSAQAAGQLK 51
            |::.::|:|...|::|.             :.|::||.:|. ..|:.|.|||.:|.:|:..|.||
  Fly     1 MQYTLLFIAALLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLK 65

  Fly    52 NVGTDEEALNVKGTYSFVADDGQTYSIAYTADENGYQPQGAHLPVAPVV 100
            |.|||......:|::|:.:.:|....|.|.|||||:||||.|||..|.:
  Fly    66 NPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPI 114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:278791 22/54 (41%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.