DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and TOM40

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_013930.1 Gene:TOM40 SGDID:S000004816 Length:387 Species:Saccharomyces cerevisiae

Alignment Length:318 Identity:94/319 (29%)
Similarity:157/319 (49%) Gaps:50/319 (16%)


  Fly    57 LENPGTVEELHKK-CKDI--QAITFEGAKIMLNKGLSNH--FQVSHTINMSNVVPSGYRFGATYV 116
            |.||||||.|:|: .:|:  ....|.|.:..|||..|.:  ||.|||.::.:.....|.|.|.:.
Yeast    57 LVNPGTVENLNKEVSRDVFLSQYFFTGLRADLNKAFSMNPAFQTSHTFSIGSQALPKYAFSALFA 121

  Fly   117 GTKEFSPTEAFPVLLGDIDPAGNLNANVIHQFSARLRCKFASQIQESKVVASQLTTDYRGSDYTL 181
            ....|:.        |:||...:::..:.:.:..:...|...||.:.:....||..||:.||:::
Yeast   122 NDNLFAQ--------GNIDNDLSVSGRLNYGWDKKNISKVNLQISDGQPTMCQLEQDYQASDFSV 178

  Fly   182 SLTVANPSI-----FTNSGVVVGQYLQSVTPALALGSELAY-QFGPNVPGRQIAIMSVVGRYTAG 240
            ::...|||.     ||  ||.|..:||||||.||||.|..| :...:.||.  |.:|.:.||.:.
Yeast   179 NVKTLNPSFSEKGEFT--GVAVASFLQSVTPQLALGLETLYSRTDGSAPGD--AGVSYLTRYVSK 239

  Fly   241 SSVW--SGTLGQSG-LHVCYYQKASDQLQIGAEVETSLR----------------MQESV---AT 283
            ...|  ||.|..:| |....::|.:..::.|  :||:|:                :|.:|   .|
Yeast   240 KQDWIFSGQLQANGALIASLWRKVAQNVEAG--IETTLQAGMVPITDPLMGTPIGIQPTVEGSTT 302

  Fly   284 LAYQIDLPKANLVFRGGIDSNWQIFGVLEKRLAPLPFTLALSGRMNHVKNNFRLGCGL 341
            :..:.:..::  |:||.:|||.::...||:::.| ..::...|.::|.||:.::||||
Yeast   303 IGAKYEYRQS--VYRGTLDSNGKVACFLERKVLP-TLSVLFCGEIDHFKNDTKIGCGL 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 94/319 (29%)
TOM40NP_013930.1 Porin3_Tom40 57..360 CDD:132766 94/319 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260556657
eggNOG 1 0.900 E1_KOG3296
Hieranoid 1 1.000
Homologene 1 1.000 H101105
Inparanoid 1 1.050 105 1.000 Inparanoid score I1401
Isobase 1 0.950 0 Normalized mean entropy S1946
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001097
OrthoInspector 1 1.000 T634423
orthoMCL 1 0.900 OOG5_128889
Panther 1 1.100 LDO PTHR10802
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2855
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.