DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and AT1G50400

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_175457.1 Gene:AT1G50400 AraportID:AT1G50400 Length:310 Species:Arabidopsis thaliana

Alignment Length:335 Identity:93/336 (28%)
Similarity:152/336 (45%) Gaps:57/336 (17%)


  Fly    30 PSNSGSLTESSSSAEGLDSLAAAKDAALENPGTVEELHKKC-KDIQAITFEGAKIMLNKGLSNHF 93
            |.|:..:...:...|.:|.      :.|..|...|||:::. ..::...|||.::..||.|:..|
plant     7 PINTAQVDAKTKLDEKVDY------SNLPCPVLYEELNREATMALKPELFEGFRLDYNKSLNQKF 65

  Fly    94 QVSHTINMS-----NVVPS---------GYRFGATYVGTKEFSPTEAFPVLLGDIDPAGNLNA-- 142
            .:||:|.|.     |..||         .|.|||.::..|.:        |:|.|...|.|||  
plant    66 FLSHSILMGPTEVPNPTPSSEIIKIPTANYDFGAGFIDPKLY--------LIGRITTDGRLNARA 122

  Fly   143 --NVIHQFSARLRCKFASQIQESKVVASQLTTDYRGSDYTLSLTVANPSIFTNSGVVVGQYLQSV 205
              ::...||.:.......:..:|:   ..|..||:||||...|.:.|.|::      ...|:|.|
plant   123 KFDLTDNFSVKANALLTDEEDKSQ---GHLVIDYKGSDYRTQLQLGNNSVY------AANYIQHV 178

  Fly   206 TPALALGSELAYQFGPNVPGRQIAIMSVVG---RYTAGSSVWSGTLGQSGLHVC-YYQKASDQLQ 266
            ||.|:||.| |:..|..       :||.||   ||....:|.||.:..:|:.|. |..|.|::|.
plant   179 TPHLSLGGE-AFWLGQQ-------LMSGVGYAARYETDKTVASGQIASTGVAVMNYVHKVSEKLS 235

  Fly   267 IGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLEKRLAPLPFTLALSGRMNHV 331
            ...:...:...::..|::.|.:...::.|  ||.:|||..:...||::| |:.....||..::||
plant   236 FATDFIYNYLSRDVTASVGYDLITRQSRL--RGKVDSNGVVAAYLEEQL-PIGLRFLLSAEVDHV 297

  Fly   332 KNNFRLGCGL 341
            |.:::.|.|:
plant   298 KKDYKFGFGV 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 89/309 (29%)
AT1G50400NP_175457.1 Porin3_Tom40 28..308 CDD:132766 89/309 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H101105
Inparanoid 1 1.050 102 1.000 Inparanoid score I2096
OMA 1 1.010
OrthoDB 1 1.010 D1346842at2759
OrthoInspector 1 1.000 T32204
orthoMCL 1 0.900 OOG5_128889
Panther 1 1.100 O PTHR10802
Phylome 1 0.910 0.800 Consistency score
98.980

Return to query results.
Submit another query.