DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and TOMM40L

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_115550.2 Gene:TOMM40L HGNCID:25756 Length:308 Species:Homo sapiens

Alignment Length:326 Identity:134/327 (41%)
Similarity:193/327 (59%) Gaps:24/327 (7%)


  Fly    21 LGLQEPAPLPSNSGSLTESSSSAEGLDSLAAAKDAALENPGTVEELHKKCKDIQAITFEGAKIML 85
            |||.....||..|                 ..::..|.|||:.:|||:.|||:.....||.|:::
Human     5 LGLAPMGTLPRRS-----------------PRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVV 52

  Fly    86 NKGLSNHFQVSHTINMSNVVPSGYRFGATYVGTKEFSPTEAFPVLLGDIDPAGNLNANVIHQFSA 150
            ||.||:||||:|||:||.:...||...|.|.|..:.||||.||.::||:|.:|:|||.|:...:.
Human    53 NKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAE 117

  Fly   151 RLRCKFASQIQESKVVASQLTTDYRGSDYTLSLTVANPSIFTNSGVVVGQYLQSVTPALALGSEL 215
            |||.|...|.|::|.:..|...:|||.|||.:||:.||.:...|.::|..:|||:|..|.||.||
Human   118 RLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPDLIGESVIMVAHFLQSLTHRLVLGGEL 182

  Fly   216 AYQFGPNVPGRQIAIMSVVGRYTAGSSVWSGTL--GQSGLHVCYYQKASDQLQIGAEVETSLRMQ 278
            .|.   ..||.:.||:::.|:|:|..  |..||  |..|.|..||.:|::|:|:|.|.|.:.|:|
Human   183 VYH---RRPGEEGAILTLAGKYSAVH--WVATLNVGSGGAHASYYHRANEQVQVGVEFEANTRLQ 242

  Fly   279 ESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLEKRLAPLPFTLALSGRMNHVKNNFRLGCGLMI 343
            ::..:..|.:.||:||:||||.:||||.:..||||::.|||.||||...:||.:|.|..|..:.:
Human   243 DTTFSFGYHLTLPQANMVFRGLVDSNWCVGAVLEKKMPPLPVTLALGAFLNHWRNRFHCGFSITV 307

  Fly   344 G 344
            |
Human   308 G 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 127/289 (44%)
TOMM40LNP_115550.2 Porin3_Tom40 24..308 CDD:132766 127/289 (44%)
Required for mitochondrial targeting. {ECO:0000250} 281..308 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3296
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 346 1.000 Inparanoid score I2276
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1346842at2759
OrthoFinder 1 1.000 FOG0001097
OrthoInspector 1 1.000 T130062
orthoMCL 1 0.900 OOG5_128889
Panther 1 1.100 O PTHR10802
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.