DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and TOM40

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_188634.1 Gene:TOM40 AraportID:AT3G20000 Length:309 Species:Arabidopsis thaliana

Alignment Length:330 Identity:91/331 (27%)
Similarity:147/331 (44%) Gaps:50/331 (15%)


  Fly    43 AEGLDSLAAAK-DAA-----------LENPGTVEELHKKC-KDIQAITFEGAKIMLNKGLSNHFQ 94
            |:.|..|.||: ||.           |.:|...||||::. ..:::..|||.:....:.|:..|.
plant     2 ADLLPPLTAAQVDAKTKVDEKVDYSNLPSPVPYEELHREALMSLKSDNFEGLRFDFTRALNQKFS 66

  Fly    95 VSHTINMSNV------------VPSG-YRFGATYVGTKEFSPTEAFPVLLGDIDPAGNLNANVIH 146
            :||::.|...            :|:. |.|||.|...|        .:|:|.:...|.|||.:..
plant    67 LSHSVMMGPTEVPAQSPETTIKIPTAHYEFGANYYDPK--------LLLIGRVMTDGRLNARLKA 123

  Fly   147 QFSARLRCKFASQI-QESKVVASQLTTDYRGSDYTLSLTVANPSIFTNSGVVVGQYLQSVTPALA 210
            ..:.:|..|..:.| .|..:..:....||.||||...|.:.      .|.::...|:||||..|:
plant   124 DLTDKLVVKANALITNEEHMSQAMFNFDYMGSDYRAQLQLG------QSALIGATYIQSVTNHLS 182

  Fly   211 LGSELAYQFGPNVPGRQIAIMSVVGRYTAGSSVWSGTLGQSGLHVC-YYQKASDQLQIGAEVETS 274
            ||.|:.:...|...|     :....||.....|.||.:..:|..|. |.||.||::.:..:...:
plant   183 LGGEIFWAGVPRKSG-----IGYAARYETDKMVASGQVASTGAVVMNYVQKISDKVSLATDFMYN 242

  Fly   275 LRMQESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLEKRLAPLPFTLALSGRMNHVKNNFRLGC 339
            ...::..|::.|...|.:|.:  ||.||||.....:||:||: :.....||..::|.|.:::.|.
plant   243 YFSRDVTASVGYDYMLRQARV--RGKIDSNGVASALLEERLS-MGLNFLLSAELDHKKKDYKFGF 304

  Fly   340 GLMIG 344
            ||.:|
plant   305 GLTVG 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 83/303 (27%)
TOM40NP_188634.1 Porin3_Tom40 28..309 CDD:132766 83/303 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I2096
OMA 1 1.010
OrthoDB 1 1.010 D1346842at2759
OrthoInspector 1 1.000 T32204
orthoMCL 1 0.900 OOG5_128889
Panther 1 1.100 LDO PTHR10802
Phylome 1 0.910 0.800 Consistency score
87.980

Return to query results.
Submit another query.