DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and Tomm40l

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001032247.1 Gene:Tomm40l MGIID:3589112 Length:308 Species:Mus musculus

Alignment Length:326 Identity:132/327 (40%)
Similarity:192/327 (59%) Gaps:24/327 (7%)


  Fly    21 LGLQEPAPLPSNSGSLTESSSSAEGLDSLAAAKDAALENPGTVEELHKKCKDIQAITFEGAKIML 85
            |||.....||..|                 ..::..|.|||:.:|||:.|||:.....||.|:::
Mouse     5 LGLAPMGTLPRRS-----------------HRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVV 52

  Fly    86 NKGLSNHFQVSHTINMSNVVPSGYRFGATYVGTKEFSPTEAFPVLLGDIDPAGNLNANVIHQFSA 150
            ||.||:||||:||::||.:...||.....|.|..:.||||.||.::||:|.:|:|||.|:...:.
Mouse    53 NKVLSSHFQVAHTVHMSALGLPGYHLHTAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAE 117

  Fly   151 RLRCKFASQIQESKVVASQLTTDYRGSDYTLSLTVANPSIFTNSGVVVGQYLQSVTPALALGSEL 215
            |||.|...|.|::|.:..|...:|||.|||.:||:.||.:...|.::|..:|||:|..|.||.||
Mouse   118 RLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPDLIGESVIMVAHFLQSITHRLVLGGEL 182

  Fly   216 AYQFGPNVPGRQIAIMSVVGRYTAGSSVWSGTL--GQSGLHVCYYQKASDQLQIGAEVETSLRMQ 278
            .|.   ..||.:.||:::.|:|:|..  |..||  |..|.|..||.||::|:|:|.|.|.:.|:|
Mouse   183 VYH---RRPGEEGAILTLAGKYSAVH--WVATLNVGSGGAHASYYHKANEQVQVGVEFEANTRLQ 242

  Fly   279 ESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLEKRLAPLPFTLALSGRMNHVKNNFRLGCGLMI 343
            ::..:..|.:.||:|::||||.:||||.:..||||::.|||.||||...:||.:|.|..|..:.:
Mouse   243 DTTFSFGYHLTLPQADMVFRGLVDSNWCVGAVLEKKMRPLPVTLALGAFLNHWRNRFHCGFSITV 307

  Fly   344 G 344
            |
Mouse   308 G 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 125/289 (43%)
Tomm40lNP_001032247.1 Porin3_Tom40 24..308 CDD:132766 125/289 (43%)
Required for mitochondrial targeting. {ECO:0000250} 281..308 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260518394
eggNOG 1 0.900 E1_KOG3296
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 337 1.000 Inparanoid score I2358
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001097
OrthoInspector 1 1.000 T130842
orthoMCL 1 0.900 OOG5_128889
Panther 1 1.100 O PTHR10802
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.