DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and si:dkey-71l1.1

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001107910.1 Gene:si:dkey-71l1.1 ZFINID:ZDB-GENE-070705-489 Length:318 Species:Danio rerio

Alignment Length:346 Identity:133/347 (38%)
Similarity:202/347 (58%) Gaps:30/347 (9%)


  Fly     1 MGNVLAASSGAPGSGASNLGLGLQEPAPLPSNSGSLTESSSSAEGLDSLAAAKDAALENPGTVEE 65
            ||:|||.|: .||          ::.:|.|.:...            |....:|..|.|||:.:.
Zfish     1 MGSVLALST-RPG----------RQNSPFPQDRPL------------SRWDRRDGRLPNPGSFDG 42

  Fly    66 LHKKCKDIQAITFEGAKIMLNKGLSNHFQVSHTINMSNVVPSGYRFGATYVGTKEFSPTEAFPVL 130
            ||:.|||:.....||.|:::||.||:.|:||||.::|.|.||.|||.|.::.:...|.....|:|
Zfish    43 LHRNCKDVFPHQIEGVKLVINKTLSSFFKVSHTFHLSAVAPSSYRFHAEHLQSDTDSKETDSPML 107

  Fly   131 LGDIDPAGNLNANVIHQFSARLRCKFASQIQESKVVASQLTTDYRGSDYTLSLTVANPSIFTNSG 195
            :|::|.:|:|||:.:...|.::|.|...|.|:::.|..|..|:|||||:|.::|:|||.:...|.
Zfish   108 IGEMDSSGSLNAHSLFHLSEKIRAKAIFQTQQAQFVTWQFETEYRGSDFTAAVTMANPDVLRESV 172

  Fly   196 VVVGQYLQSVTPALALGSELAYQFGPNVPGRQIAIMSVVGRYTAGSSVWSGTL--GQSGLHVCYY 258
            ::|..:||||:|.|.||.||.|..|....|   .|:::.|:|:..:  |..||  |:.|.|..||
Zfish   173 IMVAHFLQSVSPQLVLGGELVYHRGRAEEG---GILTLAGQYSGAN--WIATLNAGKGGAHASYY 232

  Fly   259 QKASDQLQIGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLEKRLAPLPFTLA 323
            .:|:.|:|:|.|.|.|.|.||:..:..||::||:|.:||||.:||...|.|||||||.|||.||.
Zfish   233 HRANKQIQVGVEFEASTRTQETTFSFGYQMELPEAKMVFRGMLDSRCIIGGVLEKRLYPLPATLI 297

  Fly   324 LSGRMNHVKNNFRLGCGLMIG 344
            :...:||..:..::|.|:.:|
Zfish   298 MGAFVNHRADKLQVGLGVNVG 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 120/289 (42%)
si:dkey-71l1.1NP_001107910.1 Porin3_Tom40 34..318 CDD:132766 120/289 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1346842at2759
OrthoFinder 1 1.000 FOG0001097
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.