DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and CG4520

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001287340.1 Gene:CG4520 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster

Alignment Length:284 Identity:72/285 (25%)
Similarity:128/285 (45%) Gaps:12/285 (4%)


  Fly    58 ENPGTVEELHKKCKDIQAITFEGAKIMLNKGLSNHFQVSHTINMSNVVPSGYRFGATYVGTKEFS 122
            :|||.|:.||.....:....::|.::.....|:.:..::....:|::.|||:|||..|....: .
  Fly    32 KNPGNVQNLHILAHRVMPKFYDGIELDYLHRLAPNKYITAAWVLSHIRPSGFRFGGLYTFRVQ-D 95

  Fly   123 PTEAFPVLLGDIDP---AGNLNANVIHQFSARLRCKFASQIQESKVVASQLTTDYRGSDYTLSLT 184
            .|...|.::|||.|   |.||  |:::.....||.:...|......|.||.|.::.....|.:..
  Fly    96 DTMYTPTIMGDIHPTSLAANL--NILYYPFQSLRMEAVLQKAREAAVESQYTIEWTRPCDTWTAN 158

  Fly   185 VANPSIFTNSGVVVGQYLQSVTPALALGSELAYQFGPNVPGRQIAIMSVVGRYTAGSSVWSGTLG 249
            ..|  :...||......::||:...|||.||..::  |.|.:....:::..||:..:...:.|..
  Fly   159 FYN--VRNESGRCTMSVMRSVSAHWALGGELLLEW--NDPQKLTPDLALAARYSHYNYSLAATAS 219

  Fly   250 QSGLHVCYYQKASDQLQIGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLEKR 314
            :.||.|.|:|:....:|:...:..:...::::||:.||.:.  .|....|..||:..:..:..|.
  Fly   220 RQGLDVTYWQRIHPHIQMANLLAWNRNTRKTIATICYQWNF--WNSAVHGMFDSDASVGFMWTKY 282

  Fly   315 LAPLPFTLALSGRMNHVKNNFRLG 338
            |..||..:..|..||...:.|..|
  Fly   283 LTHLPLQMGFSVVMNLPTDRFAFG 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 72/285 (25%)
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 72/284 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260550524
eggNOG 1 0.900 E1_KOG3296
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1946
OrthoDB 1 1.010 D1346842at2759
OrthoFinder 1 1.000 FOG0001097
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10802
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.