DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and tomm40

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_012812104.1 Gene:tomm40 XenbaseID:XB-GENE-995150 Length:352 Species:Xenopus tropicalis

Alignment Length:347 Identity:176/348 (51%)
Similarity:232/348 (67%) Gaps:14/348 (4%)


  Fly     1 MGNVLAASSGAPGSGASNLGLGLQEPAP---LPSNSGSLTESSSSAEGLDSLAAAKDAALENPGT 62
            |||||||||.||.:..|....||....|   :|..:| ||.:....|       .::..|.||||
 Frog    17 MGNVLAASSPAPPAAGSPPAPGLVSVPPGFTMPPVAG-LTPTPDKNE-------TQEDRLPNPGT 73

  Fly    63 VEELHKKCKDIQAITFEGAKIMLNKGLSNHFQVSHTINMSNVVPSGYRFGATYVGTKEFSPTEAF 127
            .||.|:|||::..|..||.|:.:||||||:|||:|||::|.:..|.|.|||||||||:..|.|||
 Frog    74 FEECHRKCKELFPIQMEGVKLTVNKGLSNYFQVNHTISLSMIGESNYHFGATYVGTKQLGPAEAF 138

  Fly   128 PVLLGDIDPAGNLNANVIHQFSARLRCKFASQIQESKVVASQLTTDYRGSDYTLSLTVANPSIFT 192
            |||:||:|.:|:|||.:|||.::.:|.|.|.|.|:||.|..||.|:|||.|:|.::|:.||.|..
 Frog   139 PVLVGDLDNSGSLNAQIIHQVTSNVRSKIALQTQQSKFVNWQLDTEYRGEDFTAAVTLGNPDILV 203

  Fly   193 NSGVVVGQYLQSVTPALALGSELAYQFGPNVPGRQIAIMSVVGRYTAGSSVWSGTLGQSGLHVCY 257
            .||::|..||||:||:||||.||.|.   ..||.:..:||:.|||:|.:...:.||||:|.|..|
 Frog   204 GSGILVAHYLQSITPSLALGGELVYH---RRPGEEGTVMSLAGRYSAPNWTATLTLGQAGAHATY 265

  Fly   258 YQKASDQLQIGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLEKRLAPLPFTL 322
            |.||:||||:|.|.|.|.|||::..:..||:|||||||:|:|.:||||.:...|||:|.|||.||
 Frog   266 YHKANDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTL 330

  Fly   323 ALSGRMNHVKNNFRLGCGLMIG 344
            |:...:||.||.|:.|.||.||
 Frog   331 AMGAFLNHKKNKFQCGFGLTIG 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 155/287 (54%)
tomm40XP_012812104.1 Porin3_Tom40 68..352 CDD:132766 155/287 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260530373
eggNOG 1 0.900 E1_KOG3296
Hieranoid 1 1.000
Homologene 1 1.000 H101105
Inparanoid 1 1.050 341 1.000 Inparanoid score I2178
OMA 1 1.010
OrthoDB 1 1.010 D1346842at2759
OrthoFinder 1 1.000 FOG0001097
OrthoInspector 1 1.000 T129106
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2855
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.