DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and tomboy40

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_610213.1 Gene:tomboy40 FlyBaseID:FBgn0033074 Length:340 Species:Drosophila melanogaster

Alignment Length:345 Identity:238/346 (69%)
Similarity:278/346 (80%) Gaps:6/346 (2%)


  Fly     1 MGNVLAASSGAPGS-GASNLGLGLQEPAPLPSNSGSLTESSSSAEGLDSLAAAKDAALENPGTVE 64
            ||||:|:::.|..| |..:|..||:.| ..|..||.:  .....|.|.  |.||...|.||||:|
  Fly     1 MGNVMASTADAESSRGRGHLSAGLRLP-EAPQYSGGV--PPQMVEALK--AEAKKPELTNPGTLE 60

  Fly    65 ELHKKCKDIQAITFEGAKIMLNKGLSNHFQVSHTINMSNVVPSGYRFGATYVGTKEFSPTEAFPV 129
            |||.:|:||||.||||||||:||||||||||:|||||::..||||||||||||||::.|||||||
  Fly    61 ELHSRCRDIQANTFEGAKIMVNKGLSNHFQVTHTINMNSAGPSGYRFGATYVGTKQYGPTEAFPV 125

  Fly   130 LLGDIDPAGNLNANVIHQFSARLRCKFASQIQESKVVASQLTTDYRGSDYTLSLTVANPSIFTNS 194
            |||:|||.||||||||||.::|||||||||.|:||:|.:|||.||||.||||:||:.||..||:|
  Fly   126 LLGEIDPMGNLNANVIHQLTSRLRCKFASQFQDSKLVGTQLTGDYRGRDYTLTLTMGNPGFFTSS 190

  Fly   195 GVVVGQYLQSVTPALALGSELAYQFGPNVPGRQIAIMSVVGRYTAGSSVWSGTLGQSGLHVCYYQ 259
            ||.|.|||||||..||||||.||.:||||||||:|::|.||||..|.:|||.|||.:|.|:.|||
  Fly   191 GVFVCQYLQSVTKRLALGSEFAYHYGPNVPGRQVAVLSAVGRYAFGDTVWSCTLGPAGFHLSYYQ 255

  Fly   260 KASDQLQIGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLEKRLAPLPFTLAL 324
            |||||||||.||||::|.|||.||:|||||||||:|||||.:||||.|.|||||||.||||:||:
  Fly   256 KASDQLQIGVEVETNIRQQESTATVAYQIDLPKADLVFRGSLDSNWLISGVLEKRLQPLPFSLAI 320

  Fly   325 SGRMNHVKNNFRLGCGLMIG 344
            ||||||.||:||||||||||
  Fly   321 SGRMNHQKNSFRLGCGLMIG 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 217/287 (76%)
tomboy40NP_610213.1 Porin3_Tom40 53..340 CDD:132766 217/287 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C259327193
eggNOG 1 0.900 E1_KOG3296
Homologene 1 1.000 H101105
Inparanoid 1 1.050 102 1.000 Inparanoid score I2096
Isobase 1 0.950 0 Normalized mean entropy S1946
OrthoDB 1 1.010 D1346842at2759
OrthoFinder 1 1.000 FOG0001097
orthoMCL 1 0.900 OOG5_128889
Panther 1 1.100 P PTHR10802
RoundUp 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.