DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and tomm40

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_017206807.1 Gene:tomm40 ZFINID:ZDB-GENE-030131-1365 Length:360 Species:Danio rerio

Alignment Length:352 Identity:170/353 (48%)
Similarity:232/353 (66%) Gaps:16/353 (5%)


  Fly     1 MGNVLAASSGAP----GSGASNLGLGLQEPAP---LPSNSGSLTESSSSAE-GLDSLAAAKDAAL 57
            ||:||||||..|    |.|.:..|.||....|   :|..||....|.:..: |.||     :::|
Zfish    17 MGSVLAASSPNPPPASGGGTAPAGAGLVTVPPGFTMPPVSGVPPSSGTQGQPGTDS-----ESSL 76

  Fly    58 ENPGTVEELHKKCKDIQAITFEGAKIMLNKGLSNHFQVSHTINMSNVVPSGYRFGATYVGTKEFS 122
            .||||.||.|:|||::..:..||.::::||||||||||||||.:|.:..||||||:||||:|:..
Zfish    77 PNPGTFEECHRKCKEVFPVQMEGVRLVVNKGLSNHFQVSHTITLSTLGDSGYRFGSTYVGSKQTG 141

  Fly   123 PTEAFPVLLGDIDPAGNLNANVIHQFSARLRCKFASQIQESKVVASQLTTDYRGSDYTLSLTVAN 187
            |.|:|||::||:|..|:|||.||||.:.|:|.|.|.|.|:.|.|..|...:|||.|:|.::|:.|
Zfish   142 PAESFPVMVGDMDNTGSLNAQVIHQLTNRVRSKIAIQTQQHKFVNWQCDGEYRGDDFTAAVTLGN 206

  Fly   188 PSIFTNSGVVVGQYLQSVTPALALGSELAYQFGPNVPGRQIAIMSVVGRYTAGSSVWSGTLGQSG 252
            |.:...||::|..||||::|:|.||.||.|.   ..||.:..:.|:|||||..:.|.:.|:|.:|
Zfish   207 PDVLVGSGILVAHYLQSLSPSLVLGGELVYH---KRPGEEGTVTSLVGRYTGSNYVATLTVGGAG 268

  Fly   253 LHVCYYQKASDQLQIGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLEKRLAP 317
            .|..||.||:||||:|.|.|.|.||||:..:..||:|:|||||:|:|.:||||.:...|||:|.|
Zfish   269 AHASYYHKANDQLQVGVEFEASTRMQETSVSFGYQLDVPKANLLFKGSLDSNWVVGATLEKKLLP 333

  Fly   318 LPFTLALSGRMNHVKNNFRLGCGLMIG 344
            ||.:|||...:||.||.|:.|.|:.||
Zfish   334 LPLSLALGAFLNHRKNKFQCGFGVTIG 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 147/287 (51%)
tomm40XP_017206807.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260514286
eggNOG 1 0.900 E1_KOG3296
Hieranoid 1 1.000
Homologene 1 1.000 H101105
Inparanoid 1 1.050 330 1.000 Inparanoid score I2388
OMA 1 1.010
OrthoDB 1 1.010 D1346842at2759
OrthoFinder 1 1.000 FOG0001097
OrthoInspector 1 1.000 T128575
orthoMCL 1 0.900 OOG5_128889
Panther 1 1.100 LDO PTHR10802
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2855
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.