DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and Tomm40

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_997685.1 Gene:Tomm40 RGDID:1303022 Length:361 Species:Rattus norvegicus

Alignment Length:365 Identity:178/366 (49%)
Similarity:234/366 (64%) Gaps:25/366 (7%)


  Fly     1 MGNVLAASS---GAPGSGASNLGLGLQEPAPLP---------------SNSGSLTESSSSAEGLD 47
            |||||||||   |.|.....:| :||..|.|.|               ||:|..:|.:..|....
  Rat     1 MGNVLAASSPPAGPPPPPTPSL-VGLPPPPPSPPGFTLPPLGGGLGTGSNAGRGSERTPGAAASG 64

  Fly    48 SLAAAKD---AALENPGTVEELHKKCKDIQAITFEGAKIMLNKGLSNHFQVSHTINMSNVVPSGY 109
            :.|::.|   ..|.||||.||.|:|||::..:..||.|:.:||||||.|||:||:.:..:..|.|
  Rat    65 AAASSNDGNCGCLPNPGTFEECHRKCKELFPVQMEGVKLTVNKGLSNRFQVTHTVALGTIGESNY 129

  Fly   110 RFGATYVGTKEFSPTEAFPVLLGDIDPAGNLNANVIHQFSARLRCKFASQIQESKVVASQLTTDY 174
            .||.||||||:.|||||||||:||:|.:|:|||.||||.|..||.|.|.|.|:||.|..|:..:|
  Rat   130 HFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLSPGLRSKMAIQTQQSKFVNWQVDGEY 194

  Fly   175 RGSDYTLSLTVANPSIFTNSGVVVGQYLQSVTPALALGSELAYQFGPNVPGRQIAIMSVVGRYTA 239
            ||||:|.::|:.||.:...||::|..||||:||.||||.||.|.   ..||.:..:||:.|:||.
  Rat   195 RGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYH---RRPGEKGTVMSLAGKYTL 256

  Fly   240 GSSVWSGTLGQSGLHVCYYQKASDQLQIGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSN 304
            .:.:.:.||||:|:|..||.|||||||:|.|.|.|.|||::.|:..||:||||||.:|:|.::||
  Rat   257 NNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSASFGYQLDLPKANFLFKGSVNSN 321

  Fly   305 WQIFGVLEKRLAPLPFTLALSGRMNHVKNNFRLGCGLMIG 344
            |.:...|||:|.|||.||:|...:||.||.|..|.||.||
  Rat   322 WIVGATLEKKLPPLPLTLSLCAFLNHRKNKFLCGFGLTIG 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 153/287 (53%)
Tomm40NP_997685.1 Porin3_Tom40 77..361 CDD:132766 153/287 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260512677
eggNOG 1 0.900 E1_KOG3296
Hieranoid 1 1.000
Homologene 1 1.000 H101105
Inparanoid 1 1.050 336 1.000 Inparanoid score I2284
OMA 1 1.010
OrthoDB 1 1.010 D1346842at2759
OrthoFinder 1 1.000 FOG0001097
OrthoInspector 1 1.000 T131080
orthoMCL 1 0.900 OOG5_128889
Panther 1 1.100 LDO PTHR10802
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.