DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and Tomm40l

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001076807.1 Gene:Tomm40l RGDID:1562006 Length:308 Species:Rattus norvegicus

Alignment Length:294 Identity:126/295 (43%)
Similarity:186/295 (63%) Gaps:7/295 (2%)


  Fly    53 KDAALENPGTVEELHKKCKDIQAITFEGAKIMLNKGLSNHFQVSHTINMSNVVPSGYRFGATYVG 117
            ::..|.|||:.:|||:.|||:.....||.|:::||.||:||||:||::||.:...||.....|.|
  Rat    20 REEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHFQVAHTVHMSALGLPGYHLHTAYAG 84

  Fly   118 TKEFSPTEAFPVLLGDIDPAGNLNANVIHQFSARLRCKFASQIQESKVVASQLTTDYRGSDYTLS 182
            ..:.||||.||.::||:|.:|:|||.|:...:.|||.|...|.|::|.:..|...:|||.|||.:
  Rat    85 DWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTAT 149

  Fly   183 LTVANPSIFTNSGVVVGQYLQSVTPALALGSELAYQFGPNVPGRQIAIMSVVGRYTAGSSVWSGT 247
            ||:.||.:...|.::|..:|||:|..|.||.||.|.   ..||.:.||:::.|:|:|  ..|..|
  Rat   150 LTLGNPDLIGESVIMVAHFLQSITHRLVLGGELVYH---RRPGEEGAILTLAGKYSA--LHWVAT 209

  Fly   248 L--GQSGLHVCYYQKASDQLQIGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSNWQIFGV 310
            |  |..|.|..||.||::|:|:|.|.|.:.|:|::..:..|.:.||:|::||||.:||||.:..|
  Rat   210 LNVGSGGAHASYYHKANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQADMVFRGLVDSNWCVGAV 274

  Fly   311 LEKRLAPLPFTLALSGRMNHVKNNFRLGCGLMIG 344
            |||::.|||.||||...:||.:|.|..|..:.:|
  Rat   275 LEKKMRPLPVTLALGAFLNHWRNRFHCGFSITVG 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 125/289 (43%)
Tomm40lNP_001076807.1 Porin3_Tom40 24..308 CDD:132766 125/289 (43%)
Required for mitochondrial targeting. {ECO:0000269|PubMed:17437969} 281..308 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260533862
eggNOG 1 0.900 E1_KOG3296
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 336 1.000 Inparanoid score I2284
OMA 1 1.010
OrthoDB 1 1.010 D1346842at2759
OrthoFinder 1 1.000 FOG0001097
OrthoInspector 1 1.000 T131080
orthoMCL 1 0.900 OOG5_128889
Panther 1 1.100 O PTHR10802
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.