DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and tom40

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_595546.2 Gene:tom40 PomBaseID:SPBC27B12.13 Length:344 Species:Schizosaccharomyces pombe

Alignment Length:332 Identity:93/333 (28%)
Similarity:149/333 (45%) Gaps:42/333 (13%)


  Fly    37 TESSSSAEGLDSLAAAKDAALENPGTVEELHKK-CKDI--QAITFEGAKIMLNKGL--SNHFQVS 96
            |..:...|.:||..::.:  |.||||.|.|.|: .|||  ....|.|.:..:.||.  |..|.||
pombe     9 TSVNQVGEKIDSYKSSLN--LINPGTCENLSKEVSKDILLSNYAFTGVRADVTKGFCTSPWFTVS 71

  Fly    97 HTINMSNVVPSGYRFGATYVGTKEFSPTEAFPVLLGDIDPAGNLNANVIHQFSARLRCKFASQIQ 161
            |...:.:.|...|.|...:.|...|        |.|.:|..|.:.|.:...:::.:..|...|:.
pombe    72 HAFALGSQVLPPYSFSTMFGGEPLF--------LRGSVDNDGAVQAMLNCTWNSNVLSKVQMQLS 128

  Fly   162 ESKVV-ASQLTTDYRGSDYTLSLTVANPSIFTN-SGVVVGQYLQSVTPALALGSELAYQFGPNVP 224
            ...|. ..|:..|::|.|::.|....||..... :|:.:...||||||.|:||.|..:|...:..
pombe   129 NGAVPNMCQIEHDHKGKDFSFSFKAMNPWYEEKLTGIYIISLLQSVTPKLSLGVEALWQKPSSSI 193

  Fly   225 GRQIAIMSVVGRYTAGSSVWSGTL----GQSGLHVCYYQKASDQLQIGAEVETS-LRMQESVATL 284
            |.:.|.:|.:.||.|..  |..|.    .|..:...:::|.|.:::.|.|.:.| :.:..|.|.:
pombe   194 GPEEATLSYMTRYNAAD--WIATAHLNGSQGDVTATFWRKLSPKVEAGVECQLSPVGLNHSAALM 256

  Fly   285 A-------------YQIDLPKANLVFRGGIDSNWQIFGVLEKRLAPLPFTLALSGRMNHVKNNFR 336
            .             |:.    |..::||.:||..::...||:|||| ..|||.|..::|...|.:
pombe   257 TGPKPEGLTSVGVKYEF----AQSIYRGQVDSKGRVGVYLERRLAP-AITLAFSSELDHPNRNAK 316

  Fly   337 LGCGLMI 343
            :|.||.:
pombe   317 VGLGLSL 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 89/313 (28%)
tom40NP_595546.2 Porin3_Tom40 27..324 CDD:132766 89/313 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H101105
Inparanoid 1 1.050 100 1.000 Inparanoid score I1631
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001097
OrthoInspector 1 1.000 T631355
orthoMCL 1 0.900 OOG5_128889
Panther 1 1.100 LDO PTHR10802
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2855
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.