DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and tomm-40

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_495912.1 Gene:tomm-40 WormBaseID:WBGene00007686 Length:301 Species:Caenorhabditis elegans

Alignment Length:287 Identity:141/288 (49%)
Similarity:197/288 (68%) Gaps:3/288 (1%)


  Fly    59 NPGTVEELHKKCKDIQAITFEGAKIMLNKGLSNHFQVSHTINMSNVVPSGYRFGATYVGTKEFSP 123
            |||:.||||:|.:|:....|||||:|:|||||:|||||||:::| .:.:|||||||||||.:..|
 Worm    17 NPGSYEELHRKARDVFPTCFEGAKLMVNKGLSSHFQVSHTLSLS-AMNTGYRFGATYVGTNQVGP 80

  Fly   124 TEAFPVLLGDIDPAGNLNANVIHQFSARLRCKFASQIQESKVVASQLTTDYRGSDYTLSLTVANP 188
            .||:|:||||.|..||..|.::||... .|.|...|||:.|:..:|.|.:.:|...||.||:||.
 Worm    81 AEAYPILLGDTDVNGNTTATILHQLGI-YRTKLQGQIQQGKLAGAQATIERKGRLSTLGLTLANI 144

  Fly   189 SIFTNSGVVVGQYLQSVTPALALGSELAYQFGPNVPGRQIAIMSVVGRYTAGSSVWSGTLGQSGL 253
            .:...:|::|||:|:.:||.|.:|:|:.||:|.|:||.||:::|...||||...:.:.|||.||:
 Worm   145 DLVNEAGILVGQFLRRLTPRLDVGTEMVYQYGKNIPGGQISVLSYAARYTANHFIAAATLGASGV 209

  Fly   254 HVCYYQKASDQLQIGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLEKRLA-P 317
            |:.||.|.::.|..|.|.|.:..:.|:|.|||||.:||:..:..|...|:||.:.||.||||: .
 Worm   210 HLTYYHKQNENLAFGVEFECNANVGEAVTTLAYQTELPEEGVTMRASFDTNWTVGGVFEKRLSQQ 274

  Fly   318 LPFTLALSGRMNHVKNNFRLGCGLMIG 344
            |||||||||.:||||...:.|.||:||
 Worm   275 LPFTLALSGTLNHVKAAGKFGIGLIIG 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 140/286 (49%)
tomm-40NP_495912.1 Porin3_Tom40 16..301 CDD:132766 140/286 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C259327232
eggNOG 1 0.900 E1_KOG3296
Hieranoid 1 1.000
Homologene 1 1.000 H101105
Inparanoid 1 1.050 289 1.000 Inparanoid score I1679
Isobase 1 0.950 0 Normalized mean entropy S1946
OMA 1 1.010
OrthoDB 1 1.010 D1346842at2759
OrthoFinder 1 1.000 FOG0001097
OrthoInspector 1 1.000 T375157
orthoMCL 1 0.900 OOG5_128889
Panther 1 1.100 LDO PTHR10802
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2855
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.