DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and TOMM40

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001122388.1 Gene:TOMM40 HGNCID:18001 Length:361 Species:Homo sapiens

Alignment Length:365 Identity:189/366 (52%)
Similarity:239/366 (65%) Gaps:25/366 (7%)


  Fly     1 MGNVLAASS---GAPGSGASNLGLGLQEPAP------LPSNSGSL---TESSSSAEGLDSLA--- 50
            |||||||||   |.|...|..| :||..|.|      ||...|||   |.:|.|:|.....|   
Human     1 MGNVLAASSPPAGPPPPPAPAL-VGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATAS 64

  Fly    51 ---AAKDAA---LENPGTVEELHKKCKDIQAITFEGAKIMLNKGLSNHFQVSHTINMSNVVPSGY 109
               ||:|.|   |.||||.||.|:|||::..|..||.|:.:||||||||||:||:.:|.:..|.|
Human    65 ASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNY 129

  Fly   110 RFGATYVGTKEFSPTEAFPVLLGDIDPAGNLNANVIHQFSARLRCKFASQIQESKVVASQLTTDY 174
            .||.||||||:.|||||||||:||:|.:|:|||.||||....||.|.|.|.|:||.|..|:..:|
Human   130 HFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEY 194

  Fly   175 RGSDYTLSLTVANPSIFTNSGVVVGQYLQSVTPALALGSELAYQFGPNVPGRQIAIMSVVGRYTA 239
            ||||:|.::|:.||.:...||::|..||||:||.||||.||.|.   ..||.:..:||:.|:||.
Human   195 RGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYH---RRPGEEGTVMSLAGKYTL 256

  Fly   240 GSSVWSGTLGQSGLHVCYYQKASDQLQIGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSN 304
            .:.:.:.||||:|:|..||.|||||||:|.|.|.|.|||::..:..||:|||||||:|:|.:|||
Human   257 NNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSN 321

  Fly   305 WQIFGVLEKRLAPLPFTLALSGRMNHVKNNFRLGCGLMIG 344
            |.:...|||:|.|||.||||...:||.||.|:.|.||.||
Human   322 WIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 157/287 (55%)
TOMM40NP_001122388.1 Porin3_Tom40 77..361 CDD:132766 157/287 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260512797
eggNOG 1 0.900 E1_KOG3296
Hieranoid 1 1.000
Homologene 1 1.000 H101105
Inparanoid 1 1.050 346 1.000 Inparanoid score I2276
Isobase 1 0.950 0 Normalized mean entropy S1946
OMA 1 1.010
OrthoDB 1 1.010 D1346842at2759
OrthoFinder 1 1.000 FOG0001097
OrthoInspector 1 1.000 T130062
orthoMCL 1 0.900 OOG5_128889
Panther 1 1.100 LDO PTHR10802
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2855
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.