DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tom40 and tomm40l

Sequence 1:NP_001259313.1 Gene:Tom40 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_002941197.2 Gene:tomm40l XenbaseID:XB-GENE-958939 Length:267 Species:Xenopus tropicalis

Alignment Length:252 Identity:113/253 (45%)
Similarity:160/253 (63%) Gaps:3/253 (1%)


  Fly    93 FQVSHTINMSNVVPSGYRFGATYVGTKEFSPTEAFPVLLGDIDPAGNLNANVIHQFSARLRCKFA 157
            |||||:|:||.|..|.|.|.|.|||..:.||||.||:|.||:|.||:|||.:....:.|.|.|..
 Frog    19 FQVSHSIHMSTVGQSSYHFNAKYVGDYQPSPTETFPMLTGDVDNAGSLNAQIHCLLADRFRSKAV 83

  Fly   158 SQIQESKVVASQLTTDYRGSDYTLSLTVANPSIFTNSGVVVGQYLQSVTPALALGSELAYQFGPN 222
            .|...||.:..|:..:|||.|.|::||:.||.|...|.::|..:|||:||.|.||.||.|.   .
 Frog    84 FQTYRSKFLTWQVDGEYRGDDCTVTLTLGNPDILNESVILVTHFLQSITPRLVLGGELVYH---Q 145

  Fly   223 VPGRQIAIMSVVGRYTAGSSVWSGTLGQSGLHVCYYQKASDQLQIGAEVETSLRMQESVATLAYQ 287
            ..|.:.||.::.|:|:|.:.|.:..:|..|.|..||.:|::|:.:|.|:|.:.|:||:.....|.
 Frog   146 RMGEEGAIFTMAGKYSAPNWVATLNIGYGGAHASYYHRANEQIHVGVELEANTRLQETSFAFGYH 210

  Fly   288 IDLPKANLVFRGGIDSNWQIFGVLEKRLAPLPFTLALSGRMNHVKNNFRLGCGLMIG 344
            :|:||||:||:|.:|::|.:.|:|||:|.|||.||||...|||.||.|..|..:|:|
 Frog   211 LDIPKANVVFKGSVDNSWCVGGILEKKLPPLPVTLALGAFMNHWKNKFHCGFNIMVG 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 112/251 (45%)
tomm40lXP_002941197.2 Porin3_Tom40 17..267 CDD:132766 112/251 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 341 1.000 Inparanoid score I2178
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1346842at2759
OrthoFinder 1 1.000 FOG0001097
OrthoInspector 1 1.000 T129106
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2855
TreeFam 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.