DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and KIF20B

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001271188.1 Gene:KIF20B HGNCID:7212 Length:1820 Species:Homo sapiens

Alignment Length:750 Identity:202/750 (27%)
Similarity:315/750 (42%) Gaps:178/750 (24%)


  Fly     9 VPRREVRSFLMARDPSIDRRFRPRPNKKMRLFDNIQESEEESFSEYSDTESEYKYQSSEATEGAS 73
            |||   .|::.:.||.      .||::..  ||.|:......||..:.......::|.:..    
Human    10 VPR---PSYVFSADPI------ARPSEIN--FDGIKLDLSHEFSLVAPNTEANSFESKDYL---- 59

  Fly    74 CATSAADSSNVETGPQVFLRLRPVKDASK-------AYIVSEEANVL-ITSCKVDSTS-NNVNRM 129
                           ||.||:||...:.|       .:|:..:..|| ...|.:...| .:..:|
Human    60 ---------------QVCLRIRPFTQSEKELESEGCVHILDSQTVVLKEPQCILGRLSEKSSGQM 109

  Fly   130 EKHFGFTSIFDSTVGQRDIYDTCVGPKI---MEEECVTIMTYGTSGSGKTYTLLGDDVRAGIIPR 191
            .:.|.|:.:|.....|::.:..|:...:   ::.:...|.|||.:.||||||..|.:...||:||
Human   110 AQKFSFSKVFGPATTQKEFFQGCIMQPVKDLLKGQSRLIFTYGLTNSGKTYTFQGTEENIGILPR 174

  Fly   192 ALENIFTIYQDTVFRSPKLKLING-SIVFLQDDASLKELQIRKKLLDLCPDISAHH--------- 246
            .|..:|...|:.::....||.... ..:.|..:...:|:..:..||....:::.|:         
Human   175 TLNVLFDSLQERLYTKMNLKPHRSREYLRLSSEQEKEEIASKSALLRQIKEVTVHNDSDDTLYGS 239

  Fly   247 -------QRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNL 304
                   ...::.|..........:..:...|||||.|||||.:|||..  |...|..:  ||.|
Human   240 LTNSLNISEFEESIKDYEQANLNMANSIKFSVWVSFFEIYNEYIYDLFV--PVSSKFQK--RKML 300

  Fly   305 KIVGN-KGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKY--- 365
            ::..: ||:.|||.|..:.|:.|:||.|||:||.:..:.|.|.:|..|||||.:|||.||:.   
Human   301 RLSQDVKGYSFIKDLQWIQVSDSKEAYRLLKLGIKHQSVAFTKLNNASSRSHSIFTVKILQIEDS 365

  Fly   366 NRSGITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIP 430
            ..|.:...|....||||||||...|...|.||:|..||||||:.||:|::.....:|.|....:|
Human   366 EMSRVIRVSELSLCDLAGSERTMKTQNEGERLRETGNINTSLLTLGKCINVLKNSEKSKFQQHVP 430

  Fly   431 YRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKE-----------P 484
            :|:||||...|:...||.|:.|||.::.....|:|.||||.|::||:.:...:           |
Human   431 FRESKLTHYFQSFFNGKGKICMIVNISQCYLAYDETLNVLKFSAIAQKVCVPDTLNSSQEKLFGP 495

  Fly   485 V------------------IKQHRVSYCGFMEFSKMSTCEGGDYTKELED----ENVRLQLEIEQ 527
            |                  :|:..:|:    |.|.....|..|..:|||:    :||..:|..|.
Human   496 VKSSQDVSLDSNSNSKILNVKRATISW----ENSLEDLMEDEDLVEELENAEETQNVETKLLDED 556

  Fly   528 LKYDHVLQ--MQLLEEKLRRELTATYQEIIQNNKKQYEDECEKKLLI----------------AQ 574
            |  |..|:  ...:..:.:|:|.    ::|::.||:..:|.::||.:                ||
Human   557 L--DKTLEENKAFISHEEKRKLL----DLIEDLKKKLINEKKEKLTLEFKIREEVTQEFTQYWAQ 615

  Fly   575 RESEF--MLSSQRRRYEEQIE-------DL-----------------KDEIEELKNPASDTDISD 613
            ||::|  .|..:|...||..|       ||                 |.|.||..|.....||.|
Human   616 READFKETLLQEREILEENAERRLAIFKDLVGKCDTREEAAKDICATKVETEETHNYVGFEDIID 680

  Fly   614 ------------------------DPNESKSPIEI 624
                                    ||.|:.:.:|:
Human   681 SLQDNVADIKKQAEIAHLYIASLPDPQEATACLEL 715

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 138/421 (33%)
Kinesin 93..479 CDD:278646 135/419 (32%)
GBP_C <512..603 CDD:303769 34/139 (24%)
coiled coil 576..586 CDD:293879 4/12 (33%)
coiled coil 592..603 CDD:293879 7/35 (20%)
KIF20BNP_001271188.1 KISc_KIF23_like 57..477 CDD:276819 138/443 (31%)
Kinesin 64..479 CDD:278646 135/419 (32%)
Smc 629..1455 CDD:224117 17/87 (20%)
Necessary and sufficient for interaction with SHTN1. {ECO:0000250|UniProtKB:Q80WE4} 1050..1107
DUF342 <1268..1357 CDD:302792
Interaction with PIN1. {ECO:0000269|PubMed:11470801} 1560..1820
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R641
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.