DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and KIF23

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001354734.1 Gene:KIF23 HGNCID:6392 Length:974 Species:Homo sapiens

Alignment Length:641 Identity:176/642 (27%)
Similarity:279/642 (43%) Gaps:115/642 (18%)


  Fly    64 QSSEATEGASCATSAADSSNVETGPQVFLRLRPV--KDASKAYIVSEEANVLITSCKVDSTSNNV 126
            :|:.|.............:|::....|:.|:||:  .|......|.....|.:.:.:....:.|.
Human     2 KSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNG 66

  Fly   127 NRMEKHFGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGSGKTYTLLGDDVRAGI 188
            :..|..:.|..:|.:...|::::|....|   .::..:...:.|||.:|||||:|:.|.....|:
Human    67 DYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGL 131

  Fly   189 IPRALENIFTIY-----QDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQR 248
            :||.|:.||...     :..||:|...   |...:..:.|| |.|.|.|:.:.:  |..|:..::
Human   132 LPRCLDMIFNSIGSFQAKRYVFKSNDR---NSMDIQCEVDA-LLERQKREAMPN--PKTSSSKRQ 190

  Fly   249 L---------------KQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLL------AIPPK 292
            :               .:.:|.|.::.          |:||::||||..:||||      .|.||
Human   191 VDPEFADMITVQEFCKAEEVDEDSVYG----------VFVSYIEIYNNYIYDLLEEVPFDPIKPK 245

  Fly   293 QDKLGEVPRKNLKIV--------GNKGH-VFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVN 348
            .:.. ..|.:|...|        .:|.| :::.|.|.|.|.|:|||..:...||::...|:|.:|
Human   246 WNSC-STPMRNTDFVPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLN 309

  Fly   349 ANSSRSHCVFTVDILK-----------YNRSGITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKN 402
            ..|||||.||.:.:::           ..:..||. |.....|||||||.|.|...|.||:||.|
Human   310 RESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITI-SQLSLVDLAGSERTNRTRAEGNRLREAGN 373

  Fly   403 INTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENL 467
            ||.|||.|..|:|.....|......::||||||||.|.:....|:.|:.|||.|.|..:.|||||
Human   374 INQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENL 438

  Fly   468 NVLNFASIAKNIIFKEPVIKQHRVSYCG-------------------------FMEFSKMSTCEG 507
            .|:.||.:.:.:....||.|    :.||                         ...|..:.:|| 
Human   439 QVMRFAEVTQEVEVARPVDK----AICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCE- 498

  Fly   508 GDYTKELEDENVRLQLEIEQLKYDHVLQMQLLEE--KLRRELTATYQEIIQNNKKQYEDECEKKL 570
               ..::.||....:| ||.|:..|.|:..:::|  |......|..|| ..|.....|:..:.||
Human   499 ---ILDINDEQTLPRL-IEALEKRHNLRQMMIDEFNKQSNAFKALLQE-FDNAVLSKENHMQGKL 558

  Fly   571 LIAQRESEFMLSSQR---RRYEEQIEDLKDEIEELKNPASDTDISDDPNESKSPIE 623
                .|.|.|:|.|:   .|.|::.:.|:.:||.|:.  :.|...:|....:..:|
Human   559 ----NEKEKMISGQKLEIERLEKKNKTLEYKIEILEK--TTTIYEEDKRNLQQELE 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 134/439 (31%)
Kinesin 93..479 CDD:278646 133/437 (30%)
GBP_C <512..603 CDD:303769 28/96 (29%)
coiled coil 576..586 CDD:293879 5/13 (38%)
coiled coil 592..603 CDD:293879 4/11 (36%)
KIF23NP_001354734.1 Nuclear localization signal. {ECO:0000255} 7..11 0/4 (0%)
Interaction with ARF6. {ECO:0000269|PubMed:22522702} 808..925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R641
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.