DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and SMY1

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_012844.1 Gene:SMY1 SGDID:S000001562 Length:656 Species:Saccharomyces cerevisiae

Alignment Length:615 Identity:145/616 (24%)
Similarity:234/616 (38%) Gaps:170/616 (28%)


  Fly    62 KYQSSEATEGASCATSAADSSNVETGP---QVFLRLRPVKDASKAYIVSEEANVLITSCKVDSTS 123
            |.|||     :|.:....|||.    |   :|.||..|.|.     :.:.|     ::.|:|...
Yeast     8 KEQSS-----SSVSLPTLDSSE----PCHIEVILRAIPEKG-----LQNNE-----STFKIDPYE 53

  Fly   124 NNV----------NRMEKH--FGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGS 173
            |.|          ...|.|  |.|..:||:...|.|:....|.|   .::.....|::|||.|.|
Yeast    54 NTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFS 118

  Fly   174 GKTYTLLGDDVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDL 238
            ||:|:|:|.....||:|...:.:|    ||:.::.:.|                           
Yeast   119 GKSYSLIGSKESEGILPNICKTLF----DTLEKNEETK--------------------------- 152

  Fly   239 CPDISAHHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKN 303
                            ||       |..||||.:    |||.|..||||...|:        ||.
Yeast   153 ----------------GD-------SFSVSVLAF----EIYMEKTYDLLVPLPE--------RKP 182

  Fly   304 LKI--VGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYN 366
            ||:  ..:|..:.||.:....|.|.|:....::..|......:.......||||.||.:.:.:.|
Yeast   183 LKLHRSSSKMDLEIKDICPAHVGSYEDLRSYIQAVQNVGNRMACGDKTERSRSHLVFQLHVEQRN 247

  Fly   367 R-SGITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQK-----KKN 425
            | ..|...||....||.|:|:.:....|.|.....|.:|.|:..|...:.:.|..::     .|.
Yeast   248 RKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEALKNTVRSLSMKERDSAYSAKG 312

  Fly   426 ADIIPYRDSKLTMLLQAALLGKEKLAMIVT------------------VTPLDKYYEENLNVLNF 472
            :....||:|:||.:|:.:|.|..|..:|:|                  :..::....:|...||.
Yeast   313 SHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPTTLSTLEFGDSIRQINNKVTDNTTGLNL 377

  Fly   473 ASIAKNIIFKEPVIK-QHRVSYCGFM--EFSKMSTCEG-----GDYTKELED---ENVRLQLEIE 526
            .. ..::..::..|| .:.|:....:  |...:.:...     .|..|.||:   ||::|:|:: 
Yeast   378 KK-KMDLFIQDMKIKDDNYVAQINILKAEIDSLKSLHNKSLPEDDEKKMLENTKKENIKLKLQL- 440

  Fly   527 QLKYDHVLQM----------QLLEEKLRRELTATYQEIIQ---------NNKKQYEDECEKKLLI 572
                |.:.|:          ..::|::...||...::|.|         |:..:.:.|.|.|   
Yeast   441 ----DSITQLLSSSTNEDPNNRIDEEVSEILTKRCEQIAQLELSFDRQMNSNSKLQQELEYK--- 498

  Fly   573 AQRESEFMLSSQRRRYEEQIEDLKDEIEEL 602
              :..|..|.|...|..|||:..:.||:||
Yeast   499 --KSKEEALESMNVRLLEQIQLQEREIQEL 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 102/429 (24%)
Kinesin 93..479 CDD:278646 100/427 (23%)
GBP_C <512..603 CDD:303769 29/114 (25%)
coiled coil 576..586 CDD:293879 3/10 (30%)
coiled coil 592..603 CDD:293879 5/12 (42%)
SMY1NP_012844.1 KISc_KHC_KIF5 25..364 CDD:276820 100/415 (24%)
KIP1 32..607 CDD:227392 135/583 (23%)
RILP-like <466..553 CDD:304877 19/67 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.