DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Kif23

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_006511515.1 Gene:Kif23 MGIID:1919069 Length:967 Species:Mus musculus

Alignment Length:623 Identity:170/624 (27%)
Similarity:282/624 (45%) Gaps:114/624 (18%)


  Fly    82 SNVETGPQVFLRLRPVK--DASKAYIVSEEANVLITSCKVDSTSNNVNRMEKHFGFTSIFDSTVG 144
            :|::....|:.|:||:.  |......|.....:.:.:.:....:.|.:..|..:.|..:|.:...
Mouse    20 TNLKDPVGVYCRVRPLSFPDQECCVEVINSTTLQLHTPEGYRLNRNGDYKETQYSFKRVFGTHTT 84

  Fly   145 QRDIYDTCVGPKIMEEECV-----TIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTV 204
            |::::|....|.:  ::.:     .:.|||.:|||||||:.|.....|::||.|..||.....  
Mouse    85 QKELFDVVANPLV--DDLIHGKNGLLFTYGVTGSGKTYTMTGSPGSGGLLPRCLNMIFNSIGS-- 145

  Fly   205 FRSPKLKLINGSIVFLQDDASLKELQI---------RKKLLDLCPDISAHHQRLKQVIDGDHMFE 260
            |::.:       .||..:|.:..|:|.         :::.|.:....|:..|...:..|..::.|
Mouse   146 FQAKR-------YVFKSNDRNSMEIQCEVDALLERQKREALPIPKTPSSKRQADPEFADMINVQE 203

  Fly   261 TKASTDV---SVL-VWVSFVEIYNELVYDLL------AIPPKQDKLGEVPRKNLKIV-------- 307
            ...:.:|   ||. |:||::||||..:||||      .|.||.:.. ..|.:|.:.|        
Mouse   204 FCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVQFDPIKPKWNGC-STPMRNAESVLPQSKTLR 267

  Fly   308 GNKGH-VFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILK------- 364
            .:|.| :::.|.|.|.|.|:|||..:...||::...|:|.:|..|||||.||::.:::       
Mouse   268 EDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFSIKLVQAPLDADG 332

  Fly   365 ----YNRSGITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKN 425
                ..:..||. |.....|||||||.|.|...|.||:||.|||.|||.|..|::.....|....
Mouse   333 DNVLQEKEQITI-SQLSLVDLAGSERTNRTKAEGNRLREAGNINQSLMTLRTCMEVLRENQTYGT 396

  Fly   426 ADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHR 490
            ..::||||||||.|.:....|:.|:.|||.|.|..:.|||:|.|:.||.:.:.:....||.|   
Mouse   397 NKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEESLQVMRFAEVTQEVEVARPVDK--- 458

  Fly   491 VSYCG--------------------------FMEFSKMSTCEGGDYTKELEDENVRLQLEIEQLK 529
             ..||                          ...|..:..|:    ..::.||....:| .:.|:
Mouse   459 -VICGLTPGRRYRNLPRGGPVGDEPLVPEVILQSFPPLPPCK----LLDINDEETLPKL-ADTLE 517

  Fly   530 YDHVLQMQLLEEKLRRELTATYQEIIQ------NNKKQYEDECEKKLLIAQRESEFMLSSQR--- 585
            ..|.|: ||:.|.|.::..| ::.:::      :||:.|..|   ||    .|.|.::|.|:   
Mouse   518 KRHHLR-QLMTEDLNKKCLA-FKALLKEFDNSLSNKENYVQE---KL----NEREKVISGQKLEI 573

  Fly   586 RRYEEQIEDLKDEIEELKNPASDTDISDDPNESKSPIE 623
            .|.|::.:.|:.:||.|:.  :.|...:|....:..:|
Mouse   574 ERLEKKNKTLEYKIEILEK--TTTIYEEDKRNLQQELE 609

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 132/434 (30%)
Kinesin 93..479 CDD:278646 131/432 (30%)
GBP_C <512..603 CDD:303769 27/100 (27%)
coiled coil 576..586 CDD:293879 4/13 (31%)
coiled coil 592..603 CDD:293879 4/11 (36%)
Kif23XP_006511515.1 KISc_KIF23_like 24..448 CDD:276819 132/437 (30%)
Kinesin 31..450 CDD:278646 131/432 (30%)
Fib_alpha 512..617 CDD:285864 28/111 (25%)
MKLP1_Arf_bdg 811..910 CDD:293148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R641
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.