DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and si:dkey-96l17.6

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_017211743.1 Gene:si:dkey-96l17.6 ZFINID:ZDB-GENE-060526-350 Length:454 Species:Danio rerio

Alignment Length:521 Identity:133/522 (25%)
Similarity:195/522 (37%) Gaps:138/522 (26%)


  Fly    20 ARDPSIDRRFRPR--------PNKKMRLFDNIQESEEESFSEYSDTES-------EYKYQSSEAT 69
            |.:.|:...|..|        |..|.|.:      |....|:|.|..:       .:...|||..
Zfish     8 AENVSMSLNFMGRKLRNHTVAPAAKQRAW------ETTDLSQYQDDPAVSTRVVLSHPNVSSEEL 66

  Fly    70 EGA--------------SCATSAADSSNVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCKVD 120
            .|:              :...:..|........:||.|:||:..|.:|    ::.::.:......
Zfish    67 PGSVPDLREEIQLRRPCNIHNTLLDQDKNRRKIRVFCRIRPLTRAEQA----KKGHITVACLDDY 127

  Fly   121 STSNNVNRMEKHFGFTSIFDSTVGQRDIYDTCVGPKIMEEEC------VTIMTYGTSGSGKTYTL 179
            |......|..:.|.|..||::...|.:::....|    ..:|      |.|..||.:|||||:|:
Zfish   128 SVILETPRGPREFQFDKIFNTECTQEEVFIESSG----LIQCAIDGFNVCIFAYGHTGSGKTFTM 188

  Fly   180 LGDDVR--AGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDI 242
            :||..|  .|:|||....||.|.|                                         
Zfish   189 VGDRDRRNPGLIPRTFTRIFEIIQ----------------------------------------- 212

  Fly   243 SAHHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIV 307
                       |.:..||.|.|        ...:|:||:.:.||...|      .|...|.::|.
Zfish   213 -----------DNESKFEFKVS--------AYMLELYNDRLQDLFVSP------AEAFNKRIEIK 252

  Fly   308 -GNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYN-RSGI 370
             ..||.||.:|..:....|:.|...|...|......|:|.:|..|||||.:..:.|...| .:|.
Zfish   253 RDRKGLVFAQGAETKDAASAGELFALFEQGSANRHIAATKMNVESSRSHLIIGIMIESRNLTNGS 317

  Fly   371 TTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSK 435
            .:.......|||||||...||....:||||.:||.||..||..:.|.|..|..     :|||::|
Zfish   318 VSFGKLSLVDLAGSERAAKTGAKDDQLKEANSINKSLSALGDVISALSMEQPH-----VPYRNNK 377

  Fly   436 LTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNII--------------FKEPVI 486
            ||.|:|.:|.|..|..||:.::|.|...:|.|..|.:|:..|.|.              .||.::
Zfish   378 LTQLMQDSLGGNAKTLMILNISPSDCNLDETLTSLIYATRVKAITNNAQRNVDSKEIAQLKEVIL 442

  Fly   487 K 487
            |
Zfish   443 K 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 112/398 (28%)
Kinesin 93..479 CDD:278646 111/396 (28%)
GBP_C <512..603 CDD:303769
coiled coil 576..586 CDD:293879
coiled coil 592..603 CDD:293879
si:dkey-96l17.6XP_017211743.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.