DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and cmet

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_524993.3 Gene:cmet FlyBaseID:FBgn0040232 Length:2189 Species:Drosophila melanogaster

Alignment Length:612 Identity:152/613 (25%)
Similarity:241/613 (39%) Gaps:201/613 (33%)


  Fly    77 SAADSSNVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCKVDSTSNNVNRMEKH---FGFTSI 138
            ||.::|::    ||.:::||.:..             :||........:::..:.|   :.|..:
  Fly     2 SAKNASSI----QVCIKVRPCEPG-------------LTSLWQVKERRSIHLADSHAEPYVFDYV 49

  Fly   139 FDSTVGQRDIYDTCVGPKIMEEECV-----TIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFT 198
            ||.....::::|...  |.:...|:     ||..||.:.||||||::||:...|::..|.:.||.
  Fly    50 FDEGASNQEVFDRMA--KHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQ 112

  Fly   199 IYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFETKA 263
                                                                         :..:
  Fly   113 -------------------------------------------------------------QISS 116

  Fly   264 STDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKN--LKIVGNKGHVFIKGLTSV----- 321
            .|:...|:.|.::|||||.:||||            .:||  |||     |....|:.:|     
  Fly   117 ETERDFLLRVGYIEIYNEKIYDLL------------NKKNQDLKI-----HESGNGIVNVNCEEC 164

  Fly   322 FVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRS-----GITTQSSYKFCDL 381
            .:||..:.||||.||.:..|...|::|..|||||.:|.: |::..:|     ....||.....||
  Fly   165 IITSEVDLLRLLCLGNKERTVGETNMNERSSRSHAIFKI-IIESRKSDHSDDDAVIQSVLNLVDL 228

  Fly   382 AGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNAD--IIPYRDSKLTMLLQAAL 444
            |||||.:.||..|.||||..:||.||:.|...:.:.|     :|||  ...|||||||.:|||:|
  Fly   229 AGSERADQTGARGARLKEGGHINKSLLFLSNVIKSLS-----ENADNRFTNYRDSKLTRILQASL 288

  Fly   445 LGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFMEFSKMSTCEGGD 509
            .|....::|.|:.|  ...||:.:.|:||:.||.|..|..|  ...||....|:           
  Fly   289 GGNAFTSIICTIKP--SIMEESQSTLSFATRAKKIRIKPQV--NEMVSDATMMK----------- 338

  Fly   510 YTKELEDENVRLQLEIEQLKYDHVLQMQLLEEKLRRELTATYQEIIQNNKKQYEDECEKKLLIAQ 574
                      ||:.||:      ||:.:|.||:.:.|    .|:.:::.::|.:.:.. |::...
  Fly   339 ----------RLEREIK------VLKDKLAEEERKNE----NQQKVEHLERQIKHDMH-KIICGH 382

  Fly   575 RESEFMLSSQRRRY-----------------EEQIEDLK--------------------DEIEEL 602
            ..|:.....:||.:                 |::|:...                    |.|.:.
  Fly   383 SLSDKGQQKRRRTWCPTASGSHLELAETGTTEDRIDQFPKVSHLPKPVFFHTSNAGKRWDNIPKT 447

  Fly   603 KNPASDTDISDDPN---ESKSPIEILD 626
            .|.....||..:.|   |...|.|.:|
  Fly   448 INILGSLDIGTESNSISEEFLPAECID 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 114/410 (28%)
Kinesin 93..479 CDD:278646 113/408 (28%)
GBP_C <512..603 CDD:303769 20/128 (16%)
coiled coil 576..586 CDD:293879 2/10 (20%)
coiled coil 592..603 CDD:293879 3/31 (10%)
cmetNP_524993.3 KISc 8..328 CDD:214526 118/427 (28%)
Motor_domain 8..321 CDD:277568 115/418 (28%)
Smc <680..1449 CDD:224117
TMPIT 779..>867 CDD:285135
Smc 1042..1910 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122345608
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.