DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and kif20a

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_002936881.1 Gene:kif20a XenbaseID:XB-GENE-967269 Length:910 Species:Xenopus tropicalis

Alignment Length:648 Identity:189/649 (29%)
Similarity:312/649 (48%) Gaps:108/649 (17%)


  Fly    55 SDTESEYKYQSSEATEGASCATS-AADSSNVETG----PQ-----------VFLRLRPVKDA--- 100
            ||.|....::|:.|..||....: .:|.|.:..|    ||           |::|:||..|.   
 Frog    14 SDDEENPVFESTAAECGAGIRKALLSDFSVISPGLGHPPQSMPEESNDKVMVYVRIRPFVDGELE 78

  Fly   101 ---SKAYIVSEEANVLITSCKVDS-----TSNNVNRMEKHFGFTSIFDSTVGQRDIYDTCVGPKI 157
               .:..:..|....|:.....||     |...:.:....|.|:.:|...|.|:..:|..:...:
 Frog    79 KKEDQGCVEVENEETLVLRAPKDSFAMKNTERGLGQSVHKFTFSQLFGPEVDQKQFFDGTMRQVV 143

  Fly   158 ---MEEECVTIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVF 219
               :..:...|.|||.:.||||:|:.|.....||:||::..||...||.:::|..||.::..:::
 Frog   144 KDALNGQNWLIYTYGVTNSGKTFTIQGTSKDRGILPRSIALIFNSAQDRLYKSSDLKPLSNEVMW 208

  Fly   220 LQDDASLKELQIRK-KLLD-------LCP-----------------------DISAHHQRLKQVI 253
            | |...:::.:::| .||.       :.|                       .:|:..|.:.|..
 Frog   209 L-DSKQVRQEELKKVSLLSNLREEELMTPLKRSGNESQVRAGTSVSFDSGIGGLSSTSQFVNQTC 272

  Fly   254 ----------DGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVG 308
                      :...:...:.:.||.:.:|||:.|||||.|||||...|.....   .|..|::..
 Frog   273 SQLEETCSRWNDQEVVSLQEAADVQLSIWVSYYEIYNEFVYDLLDFMPSGPNR---KRTTLRLCE 334

  Fly   309 NK-GHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDIL-KYNRSGIT 371
            :: |:.::|.||.:.|.|:|||.::||:|::..::|||.:|.||||||.:|::.|| ...::.:|
 Frog   335 DRNGNPYVKDLTWINVHSAEEAWKILRVGRKNQSFASTHLNQNSSRSHSIFSIRILHMQGKNDLT 399

  Fly   372 TQ-SSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDA-ASTVQKKKNADIIPYRDS 434
            .: |...|||||||||..:. .||.|||||.||||||..||||:.. ....|:|...:::|:|||
 Frog   400 PKISELSFCDLAGSERCKDQ-RSGDRLKEATNINTSLHTLGRCITVLRQNQQQKLRQNVVPFRDS 463

  Fly   435 KLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFMEF 499
            |||.:.||...|:.|..|||.:......|:|.|..:.|::||..::...||    :|:.......
 Frog   464 KLTRIFQAYFTGRGKSCMIVNINQCASTYDETLYAMKFSAIASQLVQAPPV----KVNIPSIQSL 524

  Fly   500 SKMST-CEGGDYTKELE-DENVRLQLE---IEQLKYDHVLQM-----QLL----EEKL------R 544
            .|.|| .....||.|.: |||...:.|   |.:...:.:||:     :|:    :|||      |
 Frog   525 IKESTMLANRSYTDEEDADENSDEESEETDIAKFNREELLQVIENMKELIVKERQEKLNMEIQIR 589

  Fly   545 RELTATYQEIIQNNKKQYED--ECEKKLL--IAQRESEFMLSSQRRRYEEQIEDLKDEIEELK 603
            :|:.:...:::|..:||:.:  |.|::||  |.:...|.:..|....|:.::|:..:.||||:
 Frog   590 KEVCSEMMDMMQQQQKQHSESLEDERELLEEIYEGRLENLKESLTNYYKHELEERDERIEELE 652

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 140/458 (31%)
Kinesin 93..479 CDD:278646 138/445 (31%)
GBP_C <512..603 CDD:303769 30/114 (26%)
coiled coil 576..586 CDD:293879 2/10 (20%)
coiled coil 592..603 CDD:293879 5/11 (45%)
kif20aXP_002936881.1 KISc_KIF23_like 61..506 CDD:276819 139/450 (31%)
Kinesin 68..507 CDD:278646 138/444 (31%)
GrpE 640..>721 CDD:295646 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 1 1.000 FOG0004952
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.