DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and kif23

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_012814357.1 Gene:kif23 XenbaseID:XB-GENE-999865 Length:970 Species:Xenopus tropicalis

Alignment Length:636 Identity:182/637 (29%)
Similarity:289/637 (45%) Gaps:122/637 (19%)


  Fly    81 SSNVETGPQVFLRLRPV--KDASKAYIVSEEANVLI---TSCKVDSTSNNVNRMEKHFGFTSIFD 140
            |:|.:....|:.|:||:  .|......|..|..|.:   ..||   .:.|....|..:.:..:|.
 Frog    20 STNQKDPVGVYCRVRPLSPSDQECCIEVINETTVQLHPPDGCK---ANRNGEYKETQYSYKQVFG 81

  Fly   141 STVGQRDIYDTCVGPKIMEEECV-----TIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIY 200
            :.|.|::::|....|.:  |:.:     .:.|||.:|||||:|:.|.....|::||.|..||...
 Frog    82 TQVTQKELFDVVSRPLV--EDVIRGKNGLLFTYGVTGSGKTHTMTGSPGDGGLLPRCLSMIFNSI 144

  Fly   201 -----QDTVFRSPKLKLINGSIVFLQDDASL--KELQIRKKLLDLCP------------DISAHH 246
                 :..||: |..|  ||..|..:.||.|  ::.:::.:|:...|            .|:...
 Frog   145 GNFQAKRYVFK-PDDK--NGMDVQNEVDALLERQKREVQPQLITRTPLSRQRMDPEFADMINIQE 206

  Fly   247 QRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLL------AIPPKQDKLGE----VPR 301
            |...:.:|.|.::.          |:||::||||..:||||      .|.||.:..|.    :|.
 Frog   207 QCKVEDVDEDSVYS----------VFVSYIEIYNNYIYDLLEEVPLDPIKPKWNTPGRNAEFIPP 261

  Fly   302 KNLKIVGNKGH-VFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTV----- 360
            ::..:..:..| ::|.|.|.|.|.|:|||..:...||:|...|:|.:|..|||||.||.:     
 Frog   262 QSRILREDLNHNMYIAGCTEVEVKSTEEAFDIFWKGQKRRRIANTQLNRESSRSHSVFMIKLAQA 326

  Fly   361 ------DILKYNRSGITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAAST 419
                  |.:...|..||. |.....|||||||.|.|...|.||:||.|||.|||.|..|::....
 Frog   327 PLDADGDNVLQEREQITL-SQLSLVDLAGSERTNRTKAEGSRLREAGNINQSLMTLRTCIEVLRE 390

  Fly   420 VQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEP 484
            .|......::||||||||.|.:....|:.|:.|||.|.|....:||:|.|:.||.:.:.:....|
 Frog   391 NQLCGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKADDFEESLQVMRFAEMTQEVEVARP 455

  Fly   485 VIKQHRVSYCGFM------------EFSKMSTCEGGDYTKELEDE---NVRLQ-------LEIEQ 527
            |.|    ..||..            |.::.....||....:.||:   .:.:|       .|:..
 Frog   456 VDK----PICGLTPGRRYRNQAFKEELTRRLEDRGGPINGDAEDQAVVEILIQSFPPLPSCELLD 516

  Fly   528 LKYDHVLQ--MQLLEEKLR-RELTA--------TYQEIIQNNKKQYEDECEKKLLIAQ---RESE 578
            ...||.|.  :::||::.| |::.|        |::.::|:    .......|..|||   .|.:
 Frog   517 ANDDHTLPKLIEVLEKRRRIRQMMAEEFNKNVSTFRAMLQD----LNGVVTAKENIAQGRMTEKD 577

  Fly   579 FMLSSQR---RRYEEQIEDLKDEIEELKNPASDTDISDDPNESKSPIEILD 626
            .|::||:   .|.:::|:.|:.:|:.|:   ..|.|.:|  |.::..:.||
 Frog   578 KMIASQKSEMERLDKKIKTLEYKIDILE---KTTTIYED--EKRTMQQDLD 623

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 139/439 (32%)
Kinesin 93..479 CDD:278646 138/437 (32%)
GBP_C <512..603 CDD:303769 27/118 (23%)
coiled coil 576..586 CDD:293879 4/13 (31%)
coiled coil 592..603 CDD:293879 4/11 (36%)
kif23XP_012814357.1 KISc_KIF23_like 25..448 CDD:276819 139/442 (31%)
Kinesin 32..450 CDD:278646 138/437 (32%)
CwlO1 543..>694 CDD:226400 21/91 (23%)
TMF_DNA_bd 569..631 CDD:289127 17/61 (28%)
MKLP1_Arf_bdg 811..911 CDD:293148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.