DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Klp54D

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001303355.1 Gene:Klp54D FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster

Alignment Length:632 Identity:170/633 (27%)
Similarity:239/633 (38%) Gaps:208/633 (33%)


  Fly    55 SDTESEYKYQSSEATEG--------ASCATSAADSSNVETGPQVFLRLRPVKDASK--------- 102
            |...:.|..:|.|...|        ||.:|.:.:.|..|....|.:|:||:.|..|         
  Fly   126 SSRNTPYFLRSRENEIGSADTLEIVASKSTGSEECSTPEDNINVVVRVRPLNDKEKRDRHGSTLQ 190

  Fly   103 ----AYIVSEEANVLITSCKVDSTSNNVNRMEKH-------FGFTSIFDSTVGQRDIYDTCVGPK 156
                ..::.|              .|:|.:...|       |.:..:|:....|.||.|.....:
  Fly   191 FPGNGQVILE--------------GNDVGQKRSHNRDSVRVFTYNVVFEPGATQEDILDYSGIKR 241

  Fly   157 IMEE-----ECVTIMTYGTSGSGKTYTLLG-----------DDVRAGIIPRALENIFTIYQDTVF 205
            |:|.     .| |...||.:|||||:||.|           .|.|.|:|               |
  Fly   242 IIEMGIEGFSC-TAFCYGQTGSGKTHTLTGPPDLFVGKPNPKDPRHGLI---------------F 290

  Fly   206 RSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFE-TKASTDVSV 269
            ||           ||                                    ::|: .|...||:.
  Fly   291 RS-----------FL------------------------------------YLFQLIKNRKDVNY 308

  Fly   270 LVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNK--GHVFIKGLTSVFVTSSEEALRL 332
            ::..||:|||||.|.|||       ..|.. ||.|.:..:|  |..|::.|.:|.....::.|.:
  Fly   309 VLKASFMEIYNERVIDLL-------NPGSA-RKPLAVRWSKKSGGFFVENLFTVDCEELDDLLAV 365

  Fly   333 LRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSG----ITTQSSYKFCDLAGSERVNNTGTS 393
            |..|.:.....|.::|.:|||||.:.||.||...::.    ::......|.||||||....|.:.
  Fly   366 LEEGMRNRAVGSHAMNDHSSRSHTILTVHILSDQQTDGGVFLSKHGKINFVDLAGSELTKKTMSE 430

  Fly   394 GLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTP 458
            |..|:||.|||.||||||.|:.:.|  ..||....||||||:||.||..:|.|.....||..|:|
  Fly   431 GKTLEEANNINKSLMVLGYCISSLS--DSKKRTGHIPYRDSQLTKLLADSLAGNGVTLMIACVSP 493

  Fly   459 LDKYYEENLNVLNFASIAKNIIFKEPVIKQ--------------HRVSYCGFMEFSKMSTC---- 505
            ....:.|.||.|.:||.||.|..| ||||.              |.:.    ||...:...    
  Fly   494 AHYNHAETLNTLRYASRAKRIRTK-PVIKMDPREALILSLKRDIHALQ----MENDHLKAALNLH 553

  Fly   506 -----EGGDYTKELEDENVRLQL--------------------EIEQLKYDHVLQMQLLE-EKLR 544
                 .||.....||     |||                    |::..:...::::.::| |.||
  Fly   554 HQAAPNGGPVENLLE-----LQLDRVSSGGGVPVPKVDLQRLPELDGSELAELVKLYMVENESLR 613

  Fly   545 ---------RELTATYQEII--QNNK--KQYED---ECEKKLLIAQR 575
                     ||.....|||:  :|.:  |:.||   .|.:..||..|
  Fly   614 QENNHLFTVRETILRDQEIVCRENERLLKKLEDVNKVCVRSPLIPAR 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 125/431 (29%)
Kinesin 93..479 CDD:278646 125/429 (29%)
GBP_C <512..603 CDD:303769 23/102 (23%)
coiled coil 576..586 CDD:293879 170/633 (27%)
coiled coil 592..603 CDD:293879
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 130/442 (29%)
KISc 166..512 CDD:276812 125/433 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122350172
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.