DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and kif20ba

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_003200393.2 Gene:kif20ba ZFINID:ZDB-GENE-041111-213 Length:1703 Species:Danio rerio

Alignment Length:607 Identity:188/608 (31%)
Similarity:295/608 (49%) Gaps:89/608 (15%)


  Fly    80 DSSNVETGPQVFLRLRPVK-------DASKAYIVSEEANVLI----TSCKVDSTSNNVNRMEKHF 133
            |||:::...:|:||:||..       ::.....:.....||:    ||.....:..:|....:.|
Zfish    36 DSSDLKEHLKVYLRIRPFSAVEIENGESQDCVTIQRPDTVLLKPPQTSLSARLSDKSVPVTAQRF 100

  Fly   134 GFTSIFDSTVGQRDIYDTCVG---PKIMEEECVTIMTYGTSGSGKTYTLLGDDVRAGIIPRALEN 195
            .|:.::.....|:||:|..|.   ..::|.:...:.|||.:.:|||:|.||.|...||:||:|..
Zfish   101 QFSQVYGPDTTQKDIFDGTVNGLVRNVLEGQNSLVFTYGVTNAGKTFTFLGPDTNPGILPRSLNM 165

  Fly   196 IFTIYQDTVFRSPKLKLIN-GSIVFLQDDASLKELQIRKKLLDLCPD------ISAHHQRLKQVI 253
            ||:..:..:|....||... ...:.|..:...:|...::.||.|..:      ||.|..: ..:.
Zfish   166 IFSSLEGRIFTQMCLKPQRCRDFIRLTKEQQNEEAASKRNLLKLFKESDAQRSISGHCSK-SDIE 229

  Fly   254 DGDHMFETKAST-DVSV------LVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRK-NLKIVGN- 309
            ||..:.:..::. ||.:      .:||||.|||||.::|||     :.......|| ||::..: 
Zfish   230 DGSMLSDVNSAVLDVEMDMHTRFSIWVSFCEIYNENIHDLL-----EQHASNASRKTNLRLCQDV 289

  Fly   310 KGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGI---T 371
            ||:.|||.|..|.|:|:||||::::||::..:.:||.:|..|||||.:|:|.|||....||   .
Zfish   290 KGNSFIKDLKWVQVSSAEEALKVMKLGKRNQSISSTKLNLLSSRSHSIFSVRILKVEDVGIPRVE 354

  Fly   372 TQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKL 436
            :.|....||||||||...|...|.|||||.||||||:.||:|::|....|:.:..  :|:|:|||
Zfish   355 SVSELALCDLAGSERCAKTQNKGERLKEAGNINTSLLSLGKCINALRNNQQARQH--VPFRESKL 417

  Fly   437 TMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIF----KEPV-IKQ--HRVSY- 493
            |..||....|:....|||.:......|:|.||||.|:::|:.::.    ..|| :|:  ..||: 
Zfish   418 THYLQGYFTGRGSACMIVNINQCSSMYDETLNVLKFSAVAQKVVVLTTKNIPVGVKRSAREVSFI 482

  Fly   494 -----CGFMEFSKM--------STCEGGDYTKELEDENVRLQLEIEQL---KYDHVLQMQLLEEK 542
                 |..|..|.:        ...|..|...|.||     |.|||..   ..|...:...:.:|
Zfish   483 INNADCREMRRSSLVRWDPSLEDVQEDSDSEDEYED-----QSEIEDTLLNSEDECTETVQINKK 542

  Fly   543 L-----------RRELTATYQEIIQNNKKQYEDECEKKL--LIAQRESEF--MLSSQRRRYEEQI 592
            |           :::|||...|:: ..:.:..||..|:.  ||:|.:.::  .:|.:|...||:.
Zfish   543 LYEGQQRLIVNTQQQLTAVQAELL-TLEARVRDEVTKEFSELISQMQEDYSERMSRERELIEERC 606

  Fly   593 EDLKDEIEELKNPASDTDISDD 614
            |   ..:|.|||....|.:.||
Zfish   607 E---RRLEILKNLVEKTAMEDD 625

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 143/421 (34%)
Kinesin 93..479 CDD:278646 141/419 (34%)
GBP_C <512..603 CDD:303769 27/109 (25%)
coiled coil 576..586 CDD:293879 2/12 (17%)
coiled coil 592..603 CDD:293879 3/11 (27%)
kif20baXP_003200393.2 Motor_domain 42..458 CDD:328930 143/424 (34%)
SMC_N <548..1295 CDD:330553 22/83 (27%)
Peptidase_M23 1169..>1427 CDD:332360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H138164
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T597232
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R641
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.