DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Kif3C

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_651939.4 Gene:Kif3C FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster

Alignment Length:646 Identity:154/647 (24%)
Similarity:237/647 (37%) Gaps:221/647 (34%)


  Fly    81 SSNVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCKVDSTSNNVNRMEKHFGFTSIFDSTVGQ 145
            |.|:    :|.:|.||:....|.........:...:..|.:.|..::: :|.|.|.|:::.....
  Fly     2 SENI----KVVVRCRPMNQTEKERNCQNIVEINEFAVSVTNPSARISQ-QKKFIFDSVYNMKTDT 61

  Fly   146 RDIYDTCVGPKIMEEECV------------TIMTYGTSGSGKTYTLLGDD---VRAGIIPRALEN 195
            ..|||         |.|.            ||..||.:|.|||:|:.||:   ...||||:..  
  Fly    62 EVIYD---------EMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNSTGIIPKCF-- 115

  Fly   196 IFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFE 260
                                                                        ||:||
  Fly   116 ------------------------------------------------------------DHIFE 120

  Fly   261 -TKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPR--KNLKIVGNKGHVFIKGLTSVF 322
             ...:|:|..|..|:::|||||.:.|||   .|.:....:..  |.|..:|    |.:..||:..
  Fly   121 RISMTTNVRYLALVTYLEIYNERIRDLL---NKNENTNVINHFLKELPGIG----VSVPTLTTQP 178

  Fly   323 VTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDI--------LKYNRSGITTQSSYKFC 379
            |.::.:....|..|.:....|:|.:|.||||||.:||:.:        :..:..|...:......
  Fly   179 VVNANQCYDWLHFGNKNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDAFGGICRGKLSLV 243

  Fly   380 DLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAAL 444
            |||||||...||..|.|||||..||.||..||..:  :|.|..|  |..:|:||||||.|||.:|
  Fly   244 DLAGSERQRKTGAQGDRLKEASQINLSLSALGNVI--SSLVDGK--AKHVPFRDSKLTRLLQDSL 304

  Fly   445 LGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNI------------------------------ 479
            .|..|..||..::|.|.:|:|.::.|.:||.||||                              
  Fly   305 GGNTKTLMISCISPTDIHYDETISTLRYASRAKNISNKPKINEDPKDARLRQYQNEILYLKRMLQ 369

  Fly   480 --------------IFKEPV-IKQH---------------RVSYCGFMEFSKMSTCEGGDYTKEL 514
                          |.|.|: |.||               |.....|...:.:.|.......:..
  Fly   370 ESQQIINKNNDPNKIIKSPLKIIQHTNMNSTKNVQIIDLGRNCKASFKTNNSILTKPNFPLIQSK 434

  Fly   515 EDENVRLQLEIEQLKY-----DHVLQMQLLEEKLRRELTAT------------------------ 550
            |:..::.:..|:.:|.     :.:...:|.|:.:.|:..|.                        
  Fly   435 EEVQLQARSRIDLIKRSLIGGERIHDFELKEKHMARKYAAQRHLSAIAIALSRVKCEDRDLLQGH 499

  Fly   551 YQEIIQ--NNKKQYEDECEKKLLIAQRE-----SEFMLSSQRRRYEEQIEDLKDEIEELKN 604
            |..|.|  :.|..|..:|::|:.:.:.|     |||.|            |.:|.::|::|
  Fly   500 YATITQEIDIKNDYIRKCKEKIKMLEMEVSDLNSEFQL------------DREDYLDEIRN 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 117/414 (28%)
Kinesin 93..479 CDD:278646 118/412 (29%)
GBP_C <512..603 CDD:303769 22/127 (17%)
coiled coil 576..586 CDD:293879 5/15 (33%)
coiled coil 592..603 CDD:293879 3/11 (27%)
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 120/423 (28%)
Kinesin 10..339 CDD:278646 118/412 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122354869
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.