| Sequence 1: | NP_001286548.1 | Gene: | sub / 44870 | FlyBaseID: | FBgn0003545 | Length: | 628 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001287592.1 | Gene: | ncd / 43517 | FlyBaseID: | FBgn0002924 | Length: | 700 | Species: | Drosophila melanogaster | 
| Alignment Length: | 440 | Identity: | 112/440 - (25%) | 
|---|---|---|---|
| Similarity: | 185/440 - (42%) | Gaps: | 103/440 - (23%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    57 TESEYKYQSSEATEGASCATSAADSS-----------NVETGPQVFLRLRPVKDASK-----AYI 105 
  Fly   106 VSEEANVLITSCKVDSTSNNVNRMEKHFGFTSIFDSTVGQRDIYDTCVGPKI---MEEECVTIMT 167 
  Fly   168 YGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTV--FRSPKLKLINGSIVFLQDDASLKELQ 230 
  Fly   231 IRKKLLDLCPDISAHHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDK 295 
  Fly   296 LGEVPRKNLKIVGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTV 360 
  Fly   361 DIL-KYNRSGITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKK 424 
  Fly   425 NADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFAS 474 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| sub | NP_001286548.1 | KISc | 89..477 | CDD:276812 | 106/397 (27%) | 
| Kinesin | 93..479 | CDD:278646 | 104/393 (26%) | ||
| GBP_C | <512..603 | CDD:303769 | |||
| coiled coil | 576..586 | CDD:293879 | |||
| coiled coil | 592..603 | CDD:293879 | |||
| ncd | NP_001287592.1 | KISc_C_terminal | 346..672 | CDD:276817 | 106/401 (26%) | 
| KISc | 348..678 | CDD:214526 | 106/399 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45437851 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||