DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sub and ncd

DIOPT Version :9

Sequence 1:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster


Alignment Length:440 Identity:112/440 - (25%)
Similarity:185/440 - (42%) Gaps:103/440 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 TESEYKYQSSEATEGASCATSAADSS-----------NVETGPQVFLRLRPVKDASK-----AYI 105
            ||...:....:|.|..:|......|:           ::....:||.|:||..::.:     .:.
  Fly   307 TEELLRCNEQQAAELETCKEQLFQSNMERKELHNTVMDLRGNIRVFCRIRPPLESEENRMCCTWT 371

  Fly   106 VSEEANVLITSCKVDSTSNNVNRMEKHFGFTSIFDSTVGQRDIYDTCVGPKI---MEEECVTIMT 167
            ..:|:.|.:.|....:.|....::   |.|..:|.....|.||:: .|.|.|   ::...:.|..
  Fly   372 YHDESTVELQSIDAQAKSKMGQQI---FSFDQVFHPLSSQSDIFE-MVSPLIQSALDGYNICIFA 432

  Fly   168 YGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTV--FRSPKLKLINGSIVFLQDDASLKELQ 230
            ||.:|||||||:.|.....|:|||.::.:|    |::  :|:...:                   
  Fly   433 YGQTGSGKTYTMDGVPESVGVIPRTVDLLF----DSIRGYRNLGWE------------------- 474

  Fly   231 IRKKLLDLCPDISAHHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDK 295
                                        :|.||          :|:|||||::||||:...|..:
  Fly   475 ----------------------------YEIKA----------TFLEIYNEVLYDLLSNEQKDME 501

  Fly   296 LGEVPRKNLKIVGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTV 360
            :...  ||     ||..:::..:|...|........|:...:.....|||:.|..|||||.|..:
  Fly   502 IRMA--KN-----NKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKL 559

  Fly   361 DIL-KYNRSGITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKK 424
            ::: ::......:..|....||||||    :..:..|:.|.||||.||..|...:  .:.:||: 
  Fly   560 ELIGRHAEKQEISVGSINLVDLAGSE----SPKTSTRMTETKNINRSLSELTNVI--LALLQKQ- 617

  Fly   425 NADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFAS 474
              |.||||:||||.||..:|.|..|..|.:.|:|....::|::..|.||:
  Fly   618 --DHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAA 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 106/397 (27%)
Kinesin 93..479 CDD:278646 104/393 (26%)
GBP_C <512..603 CDD:303769
coiled coil 576..586 CDD:293879
coiled coil 592..603 CDD:293879
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 106/401 (26%)
KISc 348..678 CDD:214526 106/399 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.