DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Klp98A

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_524532.2 Gene:Klp98A FlyBaseID:FBgn0004387 Length:1265 Species:Drosophila melanogaster

Alignment Length:631 Identity:154/632 (24%)
Similarity:221/632 (35%) Gaps:225/632 (36%)


  Fly    34 NKKMRLF-DNIQESEEESFSEYSDTESEYKYQSSEATEGASCATSAADSSNVETGPQVFLRLRPV 97
            |||.||. ..:|...:.....:.|...:|.|.|.:           |:..:..|..||:      
  Fly    30 NKKTRLLKPRLQSIRDAGRDNHHDFTFDYSYWSFD-----------AEDPHFATQEQVY------ 77

  Fly    98 KDASKAYIVSEEANVLITSCKVDSTSNNVNRMEKHFGFTSIFDSTVGQRDIYDTCVGPKIMEEEC 162
                     |:..|.:: .|..:.                           |:.||         
  Fly    78 ---------SDLGNDVV-DCAYEG---------------------------YNACV--------- 96

  Fly   163 VTIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLK 227
               ..||.:|||||:|::|.....|:|||..|.:|.                             
  Fly    97 ---FAYGQTGSGKTFTMMGTPNNPGLIPRICEELFA----------------------------- 129

  Fly   228 ELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPK 292
                                |::...:....:.|.|          |::|||||.|.||||....
  Fly   130 --------------------RMRVGQESGTGYRTHA----------SYLEIYNERVKDLLAAQST 164

  Fly   293 QDKLGEVPRKNLKIVGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCV 357
            ...|.....::|       ..:::.|:...|:..:|....:..|..:.|.|||::|..|||||.:
  Fly   165 GHGLRVREHRSL-------GPYVENLSQHAVSDFDEIQECIARGNAQRTTASTNMNDTSSRSHAI 222

  Fly   358 FTVDILK---YNRSGITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDA--- 416
            ||:..::   .|.....|.|.....|||||||.|.||.:|.||||..:||.||:.||..:.|   
  Fly   223 FTITFVQAVFMNDMPSETVSKIHLVDLAGSERANATGATGQRLKEGAHINKSLVTLGSVISALAE 287

  Fly   417 -------------ASTVQ-KKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENL 467
                         |:|.. ..|....||||||.||.||:.:|.|..|..||..::|.|..|.|.|
  Fly   288 QTGGGHNSSSSALATTPNGASKRVLYIPYRDSILTWLLKDSLGGNSKTIMIAALSPADCNYSETL 352

  Fly   468 NVLNFASIAKNIIFKEPVIKQHRVSYCGFMEFSKMSTCEGGDYTKELEDENVR----LQLEIEQL 528
            :.|.:|:.|||||.| |.:.                           ||.||:    |:.||.:|
  Fly   353 STLRYANRAKNIINK-PTVN---------------------------EDTNVKLIRELREEINKL 389

  Fly   529 KY-----DHVLQMQL-----LEEKLRRELTAT---------YQEIIQNNKKQ------------- 561
            |.     .|.||..|     |::|..:|...|         .|.|:|..|..             
  Fly   390 KSMLAGDIHSLQPSLKVLADLQKKEAQEKVLTEEWTEKWKVAQSILQEQKSLGLRKSGVGVVLDS 454

  Fly   562 --------YEDECEKKLLIAQRESEFMLSSQRRRYEEQIEDLKDEI 599
                    :.|......|.:.:|.|..:.|:.....:.||...|.|
  Fly   455 EMPHLIGIHNDVTTGVTLYSLKEGETRIGSEDADVAQDIELAGDGI 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 106/408 (26%)
Kinesin 93..479 CDD:278646 106/406 (26%)
GBP_C <512..603 CDD:303769 30/133 (23%)
coiled coil 576..586 CDD:293879 3/10 (30%)
coiled coil 592..603 CDD:293879 4/9 (44%)
Klp98ANP_524532.2 KISc_KIF1A_KIF1B 2..371 CDD:276816 124/474 (26%)
KISc 3..371 CDD:214526 124/474 (26%)
Kinesin_assoc 370..478 CDD:292801 24/135 (18%)
FHA 456..555 CDD:238017 9/46 (20%)
PX_KIF16B_SNX23 1131..1259 CDD:132784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122346871
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.