DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Kif19A

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_996208.1 Gene:Kif19A FlyBaseID:FBgn0038205 Length:750 Species:Drosophila melanogaster

Alignment Length:760 Identity:168/761 (22%)
Similarity:270/761 (35%) Gaps:272/761 (36%)


  Fly    66 SEATEGASCATS--AADSSNVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCKVDSTSNNVNR 128
            |.:::|.|.||:  |.:...|     |.:|:||..:|::..|.......|:       ..:....
  Fly    17 SNSSQGRSIATAQPAQEERLV-----VAVRVRPSMEATERCIEVISGGSLL-------YDDGGKS 69

  Fly   129 MEKHFGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGSGKTYTLLGDDVRAGIIP 190
            ..:.:.:..:|.....|..:|.|...|   .::......:..||.:|||||:|:||.      :|
  Fly    70 RPRQYSYDHVFRENDSQEQVYKTTTAPLVRDVLNGLNAAVFAYGATGSGKTHTMLGP------VP 128

  Fly   191 RALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDG 255
            |.       ...|..|:|.....:.:      |.|.:::.:..:.::   ||.:|       |:.
  Fly   129 RK-------KPQTSDRAPPTASCDST------DVSSQDIGLMVRAIE---DIFSH-------IES 170

  Fly   256 DHMFETKASTDVSVLVWVSFVEIYNELVYDLL----AIPPKQDKLGEVPRKNLKIVGNKGHVFIK 316
            ...:..:.|        :|::||||||:.|||    .:..::|..|:             .:.:.
  Fly   171 AEAYSCRVS--------ISYLEIYNELIRDLLNPGGPLELREDHRGQ-------------RITVA 214

  Fly   317 GLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQSSYKFCDL 381
            ||:.:..:|.:|.:.||..|.:..|...|:.|..|||||.:.::.:......| |.|......||
  Fly   215 GLSEITTSSRKEVVSLLLKGNKARTMEPTAANQTSSRSHALLSIMVQARTPLG-TKQGRLFLTDL 278

  Fly   382 AGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLG 446
            |||||...|...|.||:|..:||.||:.||..::..|     ..|..:.|||||||.||:.||.|
  Fly   279 AGSERAKKTKNRGKRLQEGAHINRSLLALGNVINGLS-----GGARYVNYRDSKLTRLLKEALSG 338

  Fly   447 KEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFMEF------------ 499
            :.|..||..|.|..|:.:|..|.|.:|..|.:|..|    .|:.|....|.:|            
  Fly   339 RCKTVMIAHVAPESKHRDETKNTLVYADRANSITTK----LQNSVYIDEFKDFPTKHYQSLVSEL 399

  Fly   500 --------SKM----------------------STCEGGDYTKELEDENVRLQLEIEQLKYDHVL 534
                    :||                      .|...|..::.:::::.:.:.|:..|:...||
  Fly   400 RDEVSRLRTKMLTERPRSGAAAAAAAAAASGSAGTAGSGAGSEAVQEQDEQRKTELRYLREQIVL 464

  Fly   535 QMQLLEEKLRREL---------------------------------------------------- 547
            ..: .:.||||:|                                                    
  Fly   465 TFK-QQMKLRRKLLEAESHLLGLELDAERQHMIISHWQGRIGKLYDAMGDDDIESEGSVALKNAW 528

  Fly   548 ---------TATYQEIIQNNKKQYEDECEKK---------------------------------- 569
                     |..|:||.:..:.:.| :|.:|                                  
  Fly   529 GELAAIEKETRRYKEIRERTEHELE-QCRQKGVKLEDELPERISSDEERELLALLCRVHELEADK 592

  Fly   570 --------------------LLIAQRE---SEFMLSSQRRRYEEQIEDLKDEIEEL--------- 602
                                ||.|:|:   .|.::|||||..||...||.||:.||         
  Fly   593 VSLQAERLARQAELRRRDLQLLRAERQRRLCEDIISSQRRLIEEGNVDLPDELRELYGLYQQEIH 657

  Fly   603 -------------KNPASDTDISDDPNESK-------SPIEILDD 627
                         |.|...|..||.|..|.       ||:..:|:
  Fly   658 AGVVTPSTSNYERKLPPIYTAGSDSPGSSSSSEWSPASPLPQIDN 702

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 107/395 (27%)
Kinesin 93..479 CDD:278646 106/393 (27%)
GBP_C <512..603 CDD:303769 34/231 (15%)
coiled coil 576..586 CDD:293879 5/13 (38%)
coiled coil 592..603 CDD:293879 6/33 (18%)
Kif19ANP_996208.1 Motor_domain 35..371 CDD:277568 108/404 (27%)
Kinesin 41..371 CDD:278646 106/393 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122352148
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.