DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and zgc:56231

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_998353.1 Gene:zgc:56231 ZFINID:ZDB-GENE-040426-1914 Length:810 Species:Danio rerio

Alignment Length:660 Identity:165/661 (25%)
Similarity:297/661 (45%) Gaps:121/661 (18%)


  Fly    43 IQESEEESFSEYSDTESEYKYQSSEATEGASCATSAADSSNVETGPQ--VFLRLRPV------KD 99
            :..:|:........|..|..:.:.....|.|..||.::::.:....|  |:|::||.      .:
Zfish     5 VDMTEDTVLVAMESTACEPHHVALPELSGVSSITSQSENAEIHEQQQLRVYLKVRPFSVEELKNN 69

  Fly   100 ASKAYIVSEEANVLIT-----SCKVDSTSNNVNRMEKHFGFTSIFDSTVGQRDIYDTCVGPKI-- 157
            ..:..:|.|::..::.     |..:.|:...:.:....|.|:.||.....|.:.::..:..::  
Zfish    70 EDQGCVVLEDSETIVLHAPKGSASMKSSEKGIGQQVYKFSFSQIFGPNCNQTEFFEGTISSQVQA 134

  Fly   158 -MEEECVTIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTVFRSPKLK--------LI 213
             :..:...:.:||.:.:|||||:.|.....||:|||||.:|.......:....||        .:
Zfish   135 FLHGKNALVFSYGVTNAGKTYTIQGSPKDPGILPRALEVLFKHIGGRQYEHMDLKPYLSSDVQKL 199

  Fly   214 NGSIVFLQDDAS------LKE----LQIRKK-----LLDLC-PDISAHH--QRLKQVIDGDHMFE 260
            :..:|.|:.:|.      |||    .::||:     :..|. .::|..|  .....:.|..|.|.
Zfish   200 DSELVKLERNAKAALFSLLKEDPEPTKLRKRSSTSSINSLSFSNVSYDHTVDSADGMADEAHCFY 264

  Fly   261 TKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIV-GNKGHVFIKGLTSVFVT 324
            :         |||:|.|||||.|||||. |.:..|...  |..|::. .:.|..:|:.|..|.|.
Zfish   265 S---------VWVAFYEIYNEHVYDLLQ-PAQSSKTKR--RAALRVCEDSTGSSYIRDLRWVNVQ 317

  Fly   325 SSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQSSYKFCDLAGSERVNN 389
            ::||..::||:|.:..:.|:|.:|.:|||||.:||:.:::...:.:...|....||||||||.|.
Zfish   318 NTEEFSKVLRVGNKNRSAAATKMNQSSSRSHSIFTIKLIRIEGADVQALSELSLCDLAGSERCNK 382

  Fly   390 TGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMIV 454
            |.|.|.|||||.|||.||::||:|:.|....|..:....:|:|:||||.|.|....|:.:.:|||
Zfish   383 TKTFGDRLKEAGNINNSLLILGKCIAALRNNQGFRTKSYVPFRESKLTRLFQGMFCGRGRASMIV 447

  Fly   455 TVTPLDKYYEENLNVLNFASIAKNI-----------------------IFKEPVIKQHRVSYCGF 496
            .:......|:|.|:|:.|:::||.:                       :.|..||....|.  .:
Zfish   448 NINQCASTYDETLHVMKFSAVAKQVLQVIPPRSLESLAPRIVGLDGKPLLKNGVIDDQAVD--DY 510

  Fly   497 MEFSKMSTCEGGDYT---------------------------------KELEDENVRLQLEIEQL 528
            :...::...:..|.:                                 ||:.|..::..:|.|:|
Zfish   511 LSEEELLDGDEADMSILPQEELVNLVESLRVKLLAERRKNLLQEIQIRKEMGDAMLQQIMEAEEL 575

  Fly   529 KYDHVLQMQLLEEKLRRELTATYQEIIQNNKKQYEDECEKKLLIAQRESEFMLSSQRRRYEEQIE 593
               |..||:.|:|....::.:|: |:.:...|::..:|..:.|    |.:::...:.:..:|::|
Zfish   576 ---HSRQMEDLKESYEEKMDSTF-EMYKEALKEHAYQCALERL----EEDYIPIEEYKEEQERVE 632

  Fly   594 DLKDEIEELK 603
            .|:..:.||:
Zfish   633 VLEKRVCELE 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 130/431 (30%)
Kinesin 93..479 CDD:278646 128/427 (30%)
GBP_C <512..603 CDD:303769 22/91 (24%)
coiled coil 576..586 CDD:293879 1/10 (10%)
coiled coil 592..603 CDD:293879 4/11 (36%)
zgc:56231NP_998353.1 KISc_KIF23_like 50..470 CDD:276819 130/432 (30%)
Kinesin 58..472 CDD:278646 128/426 (30%)
CREPT <550..>638 CDD:293174 20/96 (21%)
TBPIP <696..>757 CDD:284512
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 231 1.000 Inparanoid score I3349
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 1 1.000 FOG0004952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.