DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Klp68D

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001261726.1 Gene:Klp68D FlyBaseID:FBgn0004381 Length:784 Species:Drosophila melanogaster

Alignment Length:543 Identity:138/544 (25%)
Similarity:222/544 (41%) Gaps:138/544 (25%)


  Fly    89 QVFLRLRPVKDASKAYIVSEEANVLITS--CKVDSTSNNVNRMEKHFGFTSIFDSTVGQRDIYDT 151
            ||.:|.||:.:..::....|..||....  .::.:..:......|.|.:.:.:|::..|..:|..
  Fly    21 QVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDGNKEQRKVFTYDAAYDASATQTTLYHE 85

  Fly   152 CVGP---KIMEEECVTIMTYGTSGSGKTYTL---LGDDVRAGIIPRALENIFTIYQDTVFRSPKL 210
            .|.|   .::|.....|..||.:|:|||:|:   .|:|...|||||..|.|:.            
  Fly    86 VVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQIWL------------ 138

  Fly   211 KLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFETKASTDVSVLVWVSF 275
                                                          |:..|:   :...||.||:
  Fly   139 ----------------------------------------------HINRTE---NFQFLVDVSY 154

  Fly   276 VEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRS 340
            :|||.|.:.|||  .|..        |:|::......|::..|.::...|.|:.::::::|.:..
  Fly   155 LEIYMEELRDLL--KPNS--------KHLEVRERGSGVYVPNLHAINCKSVEDMIKVMQVGNKNR 209

  Fly   341 TYASTSVNANSSRSHCVFTVDILKYNRSGITTQ-SSYKFCDLAGSERVNNTGTSGLRLKEAKNIN 404
            |...|::|.:|||||.:|.:.|...:....|.: ......|||||||.:.||.|..|||||..||
  Fly   210 TVGFTNMNEHSSRSHAIFMIKIEMCDTETNTIKVGKLNLIDLAGSERQSKTGASAERLKEASKIN 274

  Fly   405 TSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNV 469
            .:|..||..:.|.:     :::..:||||||||.|||.:|.|..|..||..:.|.:..|.|.|..
  Fly   275 LALSSLGNVISALA-----ESSPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTT 334

  Fly   470 LNFASIAKNIIFKEPVIKQHRVSYCGFMEFSKMSTCEGGDYTKELEDENVRL---QLEIEQLKYD 531
            |.:||.||: |..:|:                          |..:.::.:|   |.|||:||..
  Fly   335 LRYASRAKS-IQNQPI--------------------------KNEDPQDAKLKEYQEEIERLKRL 372

  Fly   532 HVLQMQLLEEKLRRELTATYQEIIQNNKKQYEDECEKKLLIAQRESEFMLSSQRRRYEEQIEDLK 596
            ...|.|...||   ::||..|.:.:..|:....|....|                    |:..::
  Fly   373 IGPQQQQRSEK---QVTAKKQRVKKPKKETVTKEMSDSL--------------------QVSTIE 414

  Fly   597 DEIEELKNPASDTDISDDPNESK 619
            ..:|:..:|......||..||::
  Fly   415 QPVEDDSDPEGAESESDKENEAE 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 110/397 (28%)
Kinesin 93..479 CDD:278646 109/395 (28%)
GBP_C <512..603 CDD:303769 20/94 (21%)
coiled coil 576..586 CDD:293879 0/10 (0%)
coiled coil 592..603 CDD:293879 1/11 (9%)
Klp68DNP_001261726.1 Motor_domain 18..344 CDD:277568 111/400 (28%)
KISc 20..351 CDD:214526 114/433 (26%)
GBP_C <479..576 CDD:303769
coiled coil 547..558 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122354657
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.