DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and pav

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_477025.1 Gene:pav FlyBaseID:FBgn0011692 Length:887 Species:Drosophila melanogaster

Alignment Length:654 Identity:176/655 (27%)
Similarity:296/655 (45%) Gaps:157/655 (24%)


  Fly    80 DSSNVETGP-QVFLRLRPVK-DASKAYIVSEEANVLITSCKVDSTS----------------NNV 126
            |:|:....| .||.|:||:: ||.            :||.:|.:::                :|.
  Fly    28 DTSDKARDPVNVFCRVRPLQSDAD------------LTSLRVKNSTTIALNPQDQLLQHHKPHNG 80

  Fly   127 NRMEKHFGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGSGKTYTLLGDDVRAGI 188
            .:.|..:.|..:|.....|:|:|.....|   .:::.....:.|||.:|||||||:.|:....||
  Fly    81 AQREVQYIFKHVFQPDATQQDVYAAVAQPLVENLLKGRNSLLFTYGVTGSGKTYTMTGNLRHRGI 145

  Fly   189 IPRALENIFTIYQD-----TVFRSPKLKLINGSIVFLQDDASLK-------------ELQIRKKL 235
            :||.|:.:|....|     .||:..||   ||..:..::||.|:             ....|.| 
  Fly   146 MPRCLDVLFRTISDYQAKKFVFKPDKL---NGFEILSEEDALLERQHEMNQRFAGSGRFAFRHK- 206

  Fly   236 LDLCPDISAHHQRLKQV----IDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKL 296
             |..|:| |....::.:    :|.|:|:.          |:|:::||||..|||||.....|..|
  Fly   207 -DSDPEI-ASQASVEPIPLLGLDEDNMYS----------VFVTYIEIYNNSVYDLLEDSGIQKTL 259

  Fly   297 GEVPRKNLKIVGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVD 361
               ..|.::...|: |:|:.|:|.|.|.:.|:||.:.::||:|.....|.:||.|||||.||.:.
  Fly   260 ---QSKIIREDANR-HMFVHGVTEVEVKTVEDALEVFQMGQKRKRMGHTVLNAESSRSHSVFNIR 320

  Fly   362 ILK-----------YNRSGITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLD 415
            :::           .:|..||. |.....|||||||.:.|..:|:||:||.|||.|||.|..||:
  Fly   321 LVQAPTDSQGENVVQDRQNITV-SQLSLVDLAGSERSSRTKNTGVRLREAGNINNSLMTLRTCLE 384

  Fly   416 --------AASTVQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNF 472
                    |::.:..||    :||||||:|.:.:....|:.:::|||.:.|..:.|:||:.|:.|
  Fly   385 YLRENQLAASNGLAPKK----VPYRDSKITHMFKNYFDGEGQVSMIVCINPRIEDYDENMQVMKF 445

  Fly   473 ASIAK-----------------------NIIFKEPVIKQHRVSYCGFMEFSKMSTCEGGDYT--- 511
            |.:.:                       |.:||   |..:.::..|..|...:....|..|:   
  Fly   446 AEMTQEVQIARATPMKQDLGLTPGRRKANKLFK---IAVNNLNELGIPEAKDLEVDVGLVYSLGP 507

  Fly   512 --KELEDENVRLQLEIEQLKYDHVLQMQL-LEEKLRRELTA---TYQEIIQN------------- 557
              ...|.::...|::|.:|.  |.|:.:: ..:|||..|..   ::::::.|             
  Fly   508 DFPAYEMDSPEAQIKIRELM--HYLEQRIEKRKKLRANLDIKCDSFRQMLMNLDRDNLQLRTELA 570

  Fly   558 -NKKQYEDE------CEKKLLIAQRESEFMLSSQRRRYEEQIEDLKDEIEELKNPASDTDISDDP 615
             .|..|:.|      .|||:.|.:...: :|::...:.|.|||:|..::.|.:|..:..:...:.
  Fly   571 SLKAVYKQERDRSAALEKKVRIHESSID-VLNNTLSKQERQIEELTFKLNEKENMLTQKEHEKEK 634

  Fly   616 NESK 619
            .:.|
  Fly   635 QKKK 638

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 138/449 (31%)
Kinesin 93..479 CDD:278646 137/470 (29%)
GBP_C <512..603 CDD:303769 25/115 (22%)
coiled coil 576..586 CDD:293879 1/10 (10%)
coiled coil 592..603 CDD:293879 4/11 (36%)
pavNP_477025.1 KISc_KIF23_like 35..450 CDD:276819 139/452 (31%)
Kinesin 42..452 CDD:278646 136/447 (30%)
MKLP1_Arf_bdg 735..837 CDD:293148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122354377
eggNOG 1 0.900 E2759_KOG0247
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R641
54.970

Return to query results.
Submit another query.