DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Klp59D

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_611762.1 Gene:Klp59D FlyBaseID:FBgn0034827 Length:729 Species:Drosophila melanogaster

Alignment Length:656 Identity:174/657 (26%)
Similarity:256/657 (39%) Gaps:176/657 (27%)


  Fly    25 IDRRFRPRPNKKMRLFDNIQESEEESFSEYSDTESEY-----KYQSSEATEGASCATSAADSSNV 84
            ::|....|..::.|..:.:||.:....:...:...|.     :|:|:.......|.     ..|.
  Fly   169 VNRMKEQREKRRARQAEQLQEKDALRRNNPGNPNWEVSVMLRQYRSTLIFSPLRCL-----DPNG 228

  Fly    85 ETGPQ--VFLRLRPV---KDASK--AYIVSEEANVLIT---SCKVDSTSNNVNRMEKH-FGFTSI 138
            .|..|  |.:|.||:   ::.||  ..|....|:.||.   ..|||.|    ..:|.| |.|...
  Fly   229 GTVQQITVCVRKRPMSRKEENSKNLDIITVPSADSLIVHELRLKVDLT----KFLEHHKFRFDYT 289

  Fly   139 FDSTVGQRDIYDTCVGPKI---MEEECVTIMTYGTSGSGKTYTLLGD------DVRAGIIPRALE 194
            ||.......:||....|.|   .|....|...||.:|||||:|:.|:      |...||...|..
  Fly   290 FDEECSNALVYDHTARPLIRTMFEGGNATCFAYGQTGSGKTHTMGGEFFGKVQDCGTGIYAMAAR 354

  Fly   195 NIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMF 259
            ::|    :.|.| |:.:.:...|.                    |                    
  Fly   355 DVF----EEVSR-PEYRQMGAKIT--------------------C-------------------- 374

  Fly   260 ETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRK-NLKIVGN-KGHVFIKGLTSVF 322
                          ||.|||...|:|||           :|.| .|:::.: :..|.:.|||.:.
  Fly   375 --------------SFFEIYGTKVFDLL-----------LPNKPMLRVLEDARQQVVVVGLTEMP 414

  Fly   323 VTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQSSYKFCDLAGSERV 387
            ||..|:.|||:..|.:..|...||.||.|||||.||.:.:...:..|  ......|.||||:||.
  Fly   415 VTKVEDVLRLIEHGSKERTSGQTSANAKSSRSHAVFQIALHFPDSWG--PHGKCSFVDLAGNERG 477

  Fly   388 NNTGTSGLRLK-EAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLG--KEK 449
            .:|.::..:.: |...||.||:.|..|:.|.|     :.:..:|:|.||||.:|:.:.:|  |.|
  Fly   478 ADTQSADRQTRIEGAEINKSLLALKECIRALS-----RQSSHLPFRGSKLTQVLRDSFVGGKKNK 537

  Fly   450 LAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFMEFS---------KMSTC 505
            ..||..::|.....|..||.|.:|...|.:|.||   .:|..|..|..|.|         :|...
  Fly   538 TCMIAMISPSMSCVENTLNTLRYADRVKELIAKE---DEHLQSVEGDGEKSPDLNEESEPEMMAD 599

  Fly   506 EGGDYTKELEDE-NVRLQLEIEQ----------LKYDHVL----------------QMQLLEEKL 543
            |.||  :|.||| |..|.:..|:          :.::|.|                |..||.|.|
  Fly   600 EEGD--EEPEDEDNQHLTISSEEASSYNNMSYDMSFNHTLNILGPSRNVDIQEVAEQHALLVENL 662

  Fly   544 R------RELTATYQEIIQNNKKQYEDECEKKL--LIAQ----RESEFMLSSQRRRYEE-QIEDL 595
            .      |:| .|.:||     :||....|..|  |:|.    |:.....::|:...|| |....
  Fly   663 ETYAHNFRQL-KTDKEI-----EQYTQNSESALMKLLAMVNRTRDVTHNYNTQKLLKEENQNAYK 721

  Fly   596 KDEIEE 601
            |.|::|
  Fly   722 KGELDE 727

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 117/413 (28%)
Kinesin 93..479 CDD:278646 116/409 (28%)
GBP_C <512..603 CDD:303769 33/131 (25%)
coiled coil 576..586 CDD:293879 1/10 (10%)
coiled coil 592..603 CDD:293879 3/11 (27%)
Klp59DNP_611762.1 KISc_KIF2_like 233..565 CDD:276818 117/413 (28%)
Kinesin 239..566 CDD:278646 116/408 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122348945
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.