DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Khc

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_476590.1 Gene:Khc FlyBaseID:FBgn0001308 Length:975 Species:Drosophila melanogaster

Alignment Length:642 Identity:150/643 (23%)
Similarity:258/643 (40%) Gaps:195/643 (30%)


  Fly    77 SAADSSNVETGPQVFLRLRPVKD----ASKAYIVSEEANVLITSCKVDSTSNNVNRMEKHFGFTS 137
            ||......|...:|..|.||:.|    |...::|....||         ..|.::...|.:.|..
  Fly     2 SAEREIPAEDSIKVVCRFRPLNDSEEKAGSKFVVKFPNNV---------EENCISIAGKVYLFDK 57

  Fly   138 IFDSTVGQRDIYDTC---VGPKIMEEECVTIMTYGTSGSGKTYTL---LGDDVRAGIIPRALENI 196
            :|.....|..:|:..   :...::.....||..||.:.||||:|:   :||.|:.|||||.:.:|
  Fly    58 VFKPNASQEKVYNEAAKSIVTDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDSVKQGIIPRIVNDI 122

  Fly   197 FTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFET 261
            |                                                          :|::..
  Fly   123 F----------------------------------------------------------NHIYAM 129

  Fly   262 KASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNKGHV-FIKGLTSVFVTS 325
            :.:.:..:.  ||:.|||.:.:.|||          :|.:.||.:..:|..| ::||.|..||:|
  Fly   130 EVNLEFHIK--VSYYEIYMDKIRDLL----------DVSKVNLSVHEDKNRVPYVKGATERFVSS 182

  Fly   326 SEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQSSYKF-CDLAGSERVNN 389
            .|:...::..|:.....|.|::|.:|||||.||.:::.:.|.......|...: .||||||:|:.
  Fly   183 PEDVFEVIEEGKSNRHIAVTNMNEHSSRSHSVFLINVKQENLENQKKLSGKLYLVDLAGSEKVSK 247

  Fly   390 TGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMIV 454
            ||..|..|.||||||.||..||..:.|.:...|..    |||||||||.:||.:|.|..:..:::
  Fly   248 TGAEGTVLDEAKNINKSLSALGNVISALADGNKTH----IPYRDSKLTRILQESLGGNARTTIVI 308

  Fly   455 TVTPLDKYYEENLNVLNF---ASIAKNII-FKEPVIKQHRVSYCGFMEFSKMSTCEGGDYTKELE 515
            ..:|......|..:.|:|   |...||:: ..|.:..:         |:.:.       |.|| :
  Fly   309 CCSPASFNESETKSTLDFGRRAKTVKNVVCVNEELTAE---------EWKRR-------YEKE-K 356

  Fly   516 DENVRLQLEIEQL-------------KYDHVLQMQLLEE-------------------------- 541
            ::|.||:.::|:|             |.:..:.|:.|.|                          
  Fly   357 EKNARLKGKVEKLEIELARWRAGETVKAEEQINMEDLMEASTPNLEVEAAQTAAAEAALAAQRTA 421

  Fly   542 --------------KLRRELTATYQEIIQ-----NNKKQYEDECEKKLLIAQRESEFMLSSQRRR 587
                          :|..|....||::..     |.:.||.::.:::::    |.|.::::.||.
  Fly   422 LANMSASVAVNEQARLATECERLYQQLDDKDEEINQQSQYAEQLKEQVM----EQEELIANARRE 482

  Fly   588 YE----------EQIEDLKDEIEELKNPASDTDISDD------PNESKSPIEILDDD 628
            ||          ::.|..|:|::|:.....:..::.|      .|::|. |:.|:::
  Fly   483 YETLQSEMARIQQENESAKEEVKEVLQALEELAVNYDQKSQEIDNKNKD-IDALNEE 538

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 109/403 (27%)
Kinesin 93..479 CDD:278646 110/401 (27%)
GBP_C <512..603 CDD:303769 28/159 (18%)
coiled coil 576..586 CDD:293879 3/10 (30%)
coiled coil 592..603 CDD:293879 4/11 (36%)
KhcNP_476590.1 KISc_KHC_KIF5 10..333 CDD:276820 110/406 (27%)
KISc 12..340 CDD:214526 111/411 (27%)
Apolipoprotein 595..744 CDD:279749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122342519
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.