DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Khc-73

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001261000.1 Gene:Khc-73 FlyBaseID:FBgn0019968 Length:1957 Species:Drosophila melanogaster

Alignment Length:580 Identity:151/581 (26%)
Similarity:245/581 (42%) Gaps:159/581 (27%)


  Fly    89 QVFLRLRP-----VKDASKAYIVSEEANVLITSC----KVDSTSNNVNRMEKHFGFTSIF----- 139
            :|.:|:||     ::..:|..:..|:...::.:.    |::      .:..|.|.|...|     
  Fly     7 KVAVRVRPFNRREIELDTKCIVEMEKQQTILQNPPPLEKIE------RKQPKTFAFDHCFYSLNP 65

  Fly   140 --DSTVGQRDIYDTCVGPKIME------EECVTIMTYGTSGSGKTYTLLGDDVRAGIIPRALENI 196
              ::...|..::| |||..|::      ..|  |..||.:||||:||::|.....|||||..:.:
  Fly    66 EDENFASQETVFD-CVGRGILDNAFQGYNAC--IFAYGQTGSGKSYTMMGTQESKGIIPRLCDQL 127

  Fly   197 FTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFET 261
            |:                                                           ....
  Fly   128 FS-----------------------------------------------------------AIAN 133

  Fly   262 KASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNKGH----VFIKGLTSVF 322
            |::.::...|.||::|||||.|:|||  .||.:|      ::||:   :.|    .::.||:.:.
  Fly   134 KSTPELMYKVEVSYMEIYNEKVHDLL--DPKPNK------QSLKV---REHNVMGPYVDGLSQLA 187

  Fly   323 VTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTV---DILKYNRSGITTQ--SSYKFCDLA 382
            |||.::...|:..|.:..|.|:|::||.|||||.||:|   .||....:|::.:  |.....|||
  Fly   188 VTSYQDIDNLMTEGNKSRTVAATNMNAESSRSHAVFSVVLTQILTDQATGVSGEKVSRMSLVDLA 252

  Fly   383 GSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDA---ASTVQKKKNADIIPYRDSKLTMLLQAAL 444
            ||||...||..|.||||..|||.||..||..:..   .|..:|..|...:|||||.||.||:..|
  Fly   253 GSERAVKTGAVGDRLKEGSNINKSLTTLGLVISKLADQSNGKKSGNDKFVPYRDSVLTWLLKDNL 317

  Fly   445 LGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFMEFSKMSTCEGGD 509
            .|..:..|:.|::|....|||.|:.|.:|..||.|:       .|.|..                
  Fly   318 GGNSRTVMVATISPSADNYEETLSTLRYADRAKRIV-------NHAVVN---------------- 359

  Fly   510 YTKELEDENVRLQLEIEQLKYDHVLQMQLLEEKLRRELTATYQEI------IQNNKKQYEDECEK 568
                 ||.|.|:   |.:|::    :::.|...|:....:...::      .:|..||.....|:
  Fly   360 -----EDPNARI---IRELRH----EVETLRSMLKHATGSPVGDVQDKLAESENLMKQISQTWEE 412

  Fly   569 KLLIAQR-ESEFMLSSQRRRYEEQIEDLKDEIEELKNPASDTDISDDPNESKSPIEILDD 627
            ||:..:| ::|...:.::.....|...:|.|    ||.....:::.||:.::..:..|.|
  Fly   413 KLVKTERIQNERQQALEKMGISVQASGIKVE----KNKYYLVNLNADPSLNELLVYYLKD 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 122/422 (29%)
Kinesin 93..479 CDD:278646 122/420 (29%)
GBP_C <512..603 CDD:303769 19/98 (19%)
coiled coil 576..586 CDD:293879 1/10 (10%)
coiled coil 592..603 CDD:293879 2/11 (18%)
Khc-73NP_001261000.1 KISc_KIF1A_KIF1B 4..359 CDD:276816 126/438 (29%)
KISc 6..359 CDD:214526 126/438 (29%)
Kinesin_assoc 356..468 CDD:292801 25/144 (17%)
FHA 446..546 CDD:238017 4/24 (17%)
KIF1B 741..786 CDD:289208
DUF3694 <1196..1252 CDD:289256
CAP_GLY 1786..1850 CDD:279625
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122353198
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.