DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Kif20a

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001101896.1 Gene:Kif20a RGDID:1307695 Length:888 Species:Rattus norvegicus

Alignment Length:667 Identity:189/668 (28%)
Similarity:295/668 (44%) Gaps:138/668 (21%)


  Fly    72 ASCATSAADSSNVETGPQVFLRLRPV------KDASKAYIVSEEANVLITSCKVD-----STSNN 125
            ||.....|...:.....:|:||:||.      :...:..:..|....|:.....|     |....
  Rat    48 ASLEDKQAPMEDTAEKMKVYLRIRPFLTSELERQEDQGCVCIENTETLLLQAPKDSFALKSNERG 112

  Fly   126 VNRMEKHFGFTSIFDSTVGQRDIYDTCVGPKIMEEECV-----TIMTYGTSGSGKTYTLLGDDVR 185
            :.:....|.|:.||...|||...::..:  |.|.::.:     .|.|||.:.||||||:.|....
  Rat   113 IGQATHKFTFSQIFGPEVGQVSFFNLTM--KEMVKDVLRGQNWLIYTYGVTNSGKTYTIQGTSKD 175

  Fly   186 AGIIPRALENIFTIYQDTVFRSPKLK-LINGSIVFLQDDASLKELQIRKKLL--------DLCPD 241
            .||:|::|..||...|..:..:|.|| |::..:::| |...:::.:|:|..|        :|...
  Rat   176 VGILPQSLALIFNSLQGQLHPTPDLKPLLSNEVIWL-DSKQIRQEEIKKLSLLIGGLQEEELSTS 239

  Fly   242 IS-------------------AHHQRLKQVIDGDHMFET------------KASTDVSVLVWVSF 275
            :.                   |......|......:.||            ....|:...:|:||
  Rat   240 LKKRVHAESRIGASNSFDSGIAGLSSTSQFTSSSQLDETSQLWAQPDTVPVSVPADIRFSIWISF 304

  Fly   276 VEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNK-GHVFIKGLTSVFVTSSEEALRLLRLGQQR 339
            .||||||:||||..|..|.|     |:.|::..:: |:.::|.|..:.|...|||.:||::|::.
  Rat   305 FEIYNELLYDLLEPPSHQHK-----RQTLRLCEDQNGNPYVKDLNWIHVRDVEEAWKLLKVGRKN 364

  Fly   340 STYASTSVNANSSRSHCVFTVDILKYNRSG--ITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKN 402
            .::|||.:|.:|||||.:|::.||.....|  :...|....||||||||..:. .||.|||||.|
  Rat   365 QSFASTHMNQHSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKHQ-KSGERLKEAGN 428

  Fly   403 INTSLMVLGRCLDA-ASTVQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEEN 466
            |||||..||||:.| ....|.:...::||:||||||.:.|....|:.:..|||.|.|....|:|.
  Rat   429 INTSLHTLGRCIAALRQNQQNRSKQNLIPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDET 493

  Fly   467 LNVLNFASIAKNIIFKEPV----------IKQHRVSYC----------GFMEFSKMSTCEGGDYT 511
            |:...|:::|..::...||          ||:|.:...          ..:|.|.....:...|.
  Rat   494 LHAAKFSALASQLVHAPPVHLGIPSLHSFIKEHSLQVSPGLKKEGKADSDLEDSPEDEADISMYG 558

  Fly   512 KE-------------LEDENVRLQLEI---EQLKYDHVLQMQ---------------LLEEK--- 542
            ||             |::...:|||||   |::..:.|.|||               ||||.   
  Rat   559 KEELLQVVEAMKALLLKERQEKLQLEIQLREEICNEMVEQMQQREQWCSERLDTQKDLLEELYED 623

  Fly   543 ----LRRELTATYQEIIQNNKKQYED-----ECEKKLLIAQRESEFMLSSQRRR------YEEQI 592
                |:..||..|||.||...::.|:     :..|:..:||:.....||.:|.:      ..:|:
  Rat   624 KLKILKESLTTFYQEQIQERDEKIEELETLLQEAKQQPVAQQSGGCELSLRRSQRLAASASSQQL 688

  Fly   593 EDLKDEIEELKNPASDT 609
            :::|.|:|:.|.....|
  Rat   689 QEVKAELEQCKTELGST 705

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 140/448 (31%)
Kinesin 93..479 CDD:278646 138/446 (31%)
GBP_C <512..603 CDD:303769 36/140 (26%)
coiled coil 576..586 CDD:293879 3/10 (30%)
coiled coil 592..603 CDD:293879 3/11 (27%)
Kif20aNP_001101896.1 KISc_KIF23_like 62..504 CDD:276819 140/451 (31%)
Kinesin 69..505 CDD:278646 138/445 (31%)
GBP_C <539..651 CDD:303769 29/112 (26%)
coiled coil 620..631 CDD:293879 1/11 (9%)
Tmemb_cc2 637..>754 CDD:287269 17/70 (24%)
coiled coil 640..651 CDD:293879 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 1 1.000 FOG0004952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_136001
Panther 1 1.100 O PTHR24115
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.