| Sequence 1: | NP_001286548.1 | Gene: | sub / 44870 | FlyBaseID: | FBgn0003545 | Length: | 628 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001260765.1 | Gene: | cos / 35653 | FlyBaseID: | FBgn0000352 | Length: | 1201 | Species: | Drosophila melanogaster | 
| Alignment Length: | 690 | Identity: | 139/690 - (20%) | 
|---|---|---|---|
| Similarity: | 243/690 - (35%) | Gaps: | 237/690 - (34%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    10 PRREVRSFLMARDPSIDRRFRP-RPNKKMRLFDNIQESEEESFSEYSDTESEYKYQSSEATEGAS 73 
  Fly    74 CATSAADSSNV------ETGPQVFLRLRPVKDAS---KAYIVSEEA----NVLITSCKVDSTSNN 125 
  Fly   126 VNRMEKH-FGFTSIFDSTVGQRDIYDTCVGPKI---MEEECVTIMTYGTSGSGKTYTLLGD---- 182 
  Fly   183 ---DVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISA 244 
  Fly   245 HHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGN 309 
  Fly   310 KGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSS-RSHCVFTVDILK--YNRSGIT 371 
  Fly   372 TQ--SSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADI------ 428 
  Fly   429 ------IPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFA---SIAKNIIF--- 481 
  Fly   482 -----------KEPVIKQHRVSYCGFMEFSKMSTCEGGDYTKELEDENVRLQLEIEQ----LKYD 531 
  Fly   532 HVLQMQLLEEKLRRELTATYQEIIQNNKKQYEDECEKKLLIAQRESEFMLSSQRRRYEEQI---- 592 
  Fly   593 -----EDLKDEIEELKNPASDTDISDDPNESKSPIEILDD 627 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| sub | NP_001286548.1 | KISc | 89..477 | CDD:276812 | 82/425 (19%) | 
| Kinesin | 93..479 | CDD:278646 | 82/423 (19%) | ||
| GBP_C | <512..603 | CDD:303769 | 19/103 (18%) | ||
| coiled coil | 576..586 | CDD:293879 | 2/9 (22%) | ||
| coiled coil | 592..603 | CDD:293879 | 3/19 (16%) | ||
| cos | NP_001260765.1 | Motor_domain | 132..389 | CDD:277568 | 75/374 (20%) | 
| SPEC | 657..856 | CDD:295325 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45437842 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24115 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.030 | |||||