DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and cos

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001260765.1 Gene:cos FlyBaseID:FBgn0000352 Length:1201 Species:Drosophila melanogaster

Alignment Length:690 Identity:139/691 (20%)
Similarity:243/691 (35%) Gaps:237/691 (34%)


  Fly    10 PRREVRSFLMARDPSIDRRFRP-RPNKKMRLFDNIQESEEESFSEYSDTESEYKYQSSEATEGAS 73
            |.||::..|        |.|.| .|.|..:..|...:| ::|.::....|.:....|.....|.:
  Fly    13 PHRELKDLL--------RSFGPTEPKKDAQAVDEGADS-KDSEAQVPAAEKDNPSISETDPNGNA 68

  Fly    74 CATSAADSSNV------ETGPQVFLRLRPVKDAS---KAYIVSEEA----NVLITSCKVDSTSNN 125
            ...|||||..:      ::|.:.:      .|::   :|..:|..|    :.|.....:||.:..
  Fly    69 EQDSAADSKTIPDANGNDSGQKDY------PDSAYCVQAIPISASALGLPSALPGGDPMDSIAAG 127

  Fly   126 VNRMEKH-FGFTSIFDSTVGQRDIYDTCVGPKI---MEEECVTIMTYGTSGSGKTYTLLGD---- 182
            :.::..| ...|....|:..|..:|...|.|.|   :|....:::|||..|.||:|||.|:    
  Fly   128 LIQVGPHTVPVTHALPSSSSQEQVYHQTVFPLITLFLEGFDASVVTYGQRGQGKSYTLYGNVQDP 192

  Fly   183 ---DVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISA 244
               |...|::...:.:||:                                          .||.
  Fly   193 TLTDSTEGVVQLCVRDIFS------------------------------------------HISL 215

  Fly   245 HHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGN 309
            |.:|                   :..:.|.||||....|.|||                      
  Fly   216 HPER-------------------TYAINVGFVEICGGDVCDLL---------------------- 239

  Fly   310 KGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSS-RSHCVFTVDILK--YNRSGIT 371
                   |:.::..|:.:.....|::|          ::|..| .:|.:||:.:.:  .::.|:.
  Fly   240 -------GMGNIHCTNVDAVFHWLQVG----------LSARQSLPAHTLFTLTLEQQWVSKEGLL 287

  Fly   372 TQ--SSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADI------ 428
            ..  |:..|.||.|:||..:...                  ||.|||...:.::..:.:      
  Fly   288 QHRLSTASFSDLCGTERCGDQPP------------------GRPLDAGLCMLEQVISTLTDPGLM 334

  Fly   429 ------IPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFA---SIAKNIIF--- 481
                  |||..:.||.||:.:..|:.:..:|:.|:||:::..|.|..|.||   ...:|.:.   
  Fly   335 YGVNGNIPYGQTTLTTLLKDSFGGRAQTLVILCVSPLEEHLPETLGNLQFAFKVQCVRNFVIMNT 399

  Fly   482 -----------KEPVIKQHRVSYCGFMEFSKMSTCEGGDYTKELEDENVRLQLEIEQ----LKYD 531
                       .|||.:               |....|..::....:|..||....|    :...
  Fly   400 YSDDNTMIVQPAEPVPE---------------SNSSAGPLSQAGPGDNFGLQFAASQWSKLVTNA 449

  Fly   532 HVLQMQLLEEKLRRELTATYQEIIQNNKKQYEDECEKKLLIAQRESEFMLSSQRRRYEEQI---- 592
            ..|..:|::.||..|:.              :::.|:.|.:.|...|.:.|::..|.::|:    
  Fly   450 EGLFSKLIDSKLITEVE--------------KEQIEEWLFLKQECEECLSSTEAMRQQKQLVPIL 500

  Fly   593 -----EDLKDEIEELKNPASDTDISDDPNESKSPIEILDD 627
                 ||:..|....::|.||.: :|..|||..|  .|||
  Fly   501 EAEEPEDVNSEAANSESPNSDNE-NDTDNESHRP--DLDD 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 82/426 (19%)
Kinesin 93..479 CDD:278646 83/424 (20%)
GBP_C <512..603 CDD:303769 19/104 (18%)
coiled coil 576..586 CDD:293879 2/10 (20%)
coiled coil 592..603 CDD:293879 3/20 (15%)
cosNP_001260765.1 Motor_domain 132..389 CDD:277568 75/375 (20%)
SPEC 657..856 CDD:295325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122353646
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.