DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Klp31E

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001162935.1 Gene:Klp31E FlyBaseID:FBgn0032243 Length:1048 Species:Drosophila melanogaster

Alignment Length:582 Identity:158/583 (27%)
Similarity:248/583 (43%) Gaps:151/583 (26%)


  Fly    77 SAADSSNVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCKVDSTSNNVNRM-----EKHFGFT 136
            |..||.|.::..:|.:|:||           :.:..||..|::.:|.......     :|.|.|.
  Fly     3 SEVDSINKDSSVRVAVRIRP-----------QNSRELIDMCRICTTVTLGEPQIFLGSDKAFTFD 56

  Fly   137 SIFDSTVGQRDIYDTCVGPKIMEEEC----VTIMTYGTSGSGKTYTL---------LGDDVRAGI 188
            .:||:...|.|||..|| .|:::...    .|::.||.:|||||||:         ..|.|:.||
  Fly    57 YVFDTNSNQCDIYSDCV-EKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGI 120

  Fly   189 IPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVI 253
            ||||:.:||:          .::.:.||                        ..|.|     ...
  Fly   121 IPRAVRHIFS----------GIEQLEGS------------------------STSEH-----PAA 146

  Fly   254 DGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGN-KGHVFIKG 317
            .|...|.          :.|.::|:|||.::|||      |...:  ..|.||..: .|.:.|.|
  Fly   147 GGSPQFS----------LAVQYIELYNEDIFDLL------DPFNK--NSNFKIHEDASGQITISG 193

  Fly   318 LTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKY----------NRSGITT 372
            .:...:....:||:.|:.|....|.|||.:|..|||||.:||:.:.:.          :....|.
  Fly   194 ASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDNDLETL 258

  Fly   373 QSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLT 437
            .|.:.|.|||||||:..|..:|.|.:|..:||..|:.||.|:.|..  .|.|.|..:||||||||
  Fly   259 TSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALG--DKSKRALHVPYRDSKLT 321

  Fly   438 MLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFMEFSKM 502
            .|||.:|.|..:..||..|:|.|:.:.|.||.|.:|:.|:||..|                    
  Fly   322 RLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNIKNK-------------------- 366

  Fly   503 STCEGGDYTKELEDENVRLQLEIEQLKYDHVLQMQLLEEKLRRELTATYQEIIQNNKKQYEDECE 567
                    .|..:|::.|   .|.|               ||||:.|...|:::..:.:...:||
  Fly   367 --------VKINQDQSSR---TISQ---------------LRREIAALQLELLEYKQGKLIVDCE 405

  Fly   568 KKLLIAQRESE-FMLSSQRRRYEEQIEDLKDEIEELKNPASD----TDISDDPNESKSPIEI 624
            ....|:...:| .:|.|:.:|.:::::.|:..|..|....:|    .|::...::..|.:||
  Fly   406 GNTTISDTFNENKLLLSEIKRLQQRLKSLQSTIATLTQRNADLKTNLDLNKWTSDDNSDVEI 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 125/417 (30%)
Kinesin 93..479 CDD:278646 125/415 (30%)
GBP_C <512..603 CDD:303769 21/92 (23%)
coiled coil 576..586 CDD:293879 3/11 (27%)
coiled coil 592..603 CDD:293879 3/11 (27%)
Klp31ENP_001162935.1 KISc_KIF4 12..364 CDD:276823 127/423 (30%)
KISc 13..370 CDD:214526 129/456 (28%)
KASH_CCD 409..589 CDD:291334 13/60 (22%)
RasGAP <685..750 CDD:295371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122350899
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.