DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and CG5004

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_573195.1 Gene:CG5004 FlyBaseID:FBgn0260748 Length:1247 Species:Drosophila melanogaster

Alignment Length:299 Identity:58/300 (19%)
Similarity:103/300 (34%) Gaps:111/300 (37%)


  Fly   323 VTSSEEALR-------LLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQSSYKFCD 380
            :|..:.:||       |:.||..|.:.|.|                 :.|...|.||..|...|.
  Fly     3 LTKKDPSLRVAASDPHLVSLGGGRLSTAVT-----------------IHYIHIGDTTIGSAASCS 50

  Fly   381 LAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKK--KNADIIPYRDSKLTMLLQAA 443
            ::    :|.:|...|                .|     |:.:.  ....::|.:||:| ::..|.
  Fly    51 IS----LNGSGVRPL----------------HC-----TIYRSDANEVTLVPEKDSRL-LIDGAP 89

  Fly   444 LLGKEKLAM--IVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFMEFSKMSTCE 506
            :|.:.||:.  ::|:        .|.|.|.|.:..:..:.:..:....|:|....          
  Fly    90 ILEETKLSQGAMITI--------GNSNYLRFNNPDEAQMMRSAMGSNERISMPQI---------- 136

  Fly   507 GGDYTKELEDENVRLQLEIEQLKYDHVLQMQLLEEKLRRELTATYQEIIQ--NNKKQYEDECEK- 568
              |:|              :..:..|.|...|       ||.:.|:.||.  ||...||.||.| 
  Fly   137 --DFT--------------QSARQAHELSQSL-------ELESFYESIINPINNPSTYELECPKV 178

  Fly   569 ------------KLLIAQRESEFMLS-SQRRRYEEQIED 594
                        |.::.|:.:.|..: ::..|.|:|:.:
  Fly   179 FSSDLVTVNMPAKDVLGQKYASFARNLAENHRNEKQLNN 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 33/165 (20%)
Kinesin 93..479 CDD:278646 33/167 (20%)
GBP_C <512..603 CDD:303769 21/100 (21%)
coiled coil 576..586 CDD:293879 1/11 (9%)
coiled coil 592..603 CDD:293879 0/4 (0%)
CG5004NP_573195.1 FHA 41..104 CDD:278899 18/89 (20%)
PH-like 1142..1242 CDD:302622
PH 1143..1237 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122355140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.