DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and kif20a

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001154942.1 Gene:kif20a ZFINID:ZDB-GENE-050522-252 Length:921 Species:Danio rerio

Alignment Length:652 Identity:197/653 (30%)
Similarity:307/653 (47%) Gaps:115/653 (18%)


  Fly    73 SCATSAADS-----------------SNVETGP---QVFLRLRPVKDASK-------AYIVSEEA 110
            |..|.||||                 .:.:.|.   :||||:||:.:|.|       ...|..|.
Zfish    44 SVITPAADSLTPTKELVQIKSDISRRGSTDDGSDKLKVFLRIRPLTEAEKDRGEEQGCVNVQSED 108

  Fly   111 NVLITSCKVDSTSNNVNRMEK-------HFGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTI 165
            |:|:   |....|.|:...|:       .|.||.||.....|:::||..:..   .::..|...:
Zfish   109 NLLL---KAPKDSRNMKSAERGVAQSVHKFTFTKIFGPQTSQQEVYDHTIREMVRDVLRGENRLL 170

  Fly   166 MTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQ 230
            .|||.:.||||||:.|....||::||||.::|......::.:..||.:....|...|...::..:
Zfish   171 YTYGVTNSGKTYTIQGAGAEAGLLPRALVSVFLKLSGRLYTAMDLKPVLSQEVRKLDVGEVRAEE 235

  Fly   231 IRKKLLDLCPDISAHHQRLKQVIDGD----------HMFETKASTD------------------- 266
            :|:..  |..:..::..||:..:..|          |:......:|                   
Zfish   236 MRRDA--LLKEDESNQSRLRAGLSWDSGISGLSATSHIATQLEDSDGVCLEANGLCLSGGEDLEE 298

  Fly   267 -VSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNK-GHVFIKGLTSVFVTSSEEA 329
             |...|||||.|||||.:||||..||   .|....|..|::..:| |:.::|.||.:.|.|:|||
Zfish   299 GVQFSVWVSFYEIYNEFLYDLLDAPP---SLQSRKRVTLRLSDDKHGNPYVKDLTWIQVHSAEEA 360

  Fly   330 LRLLRLGQQRSTYASTSVNANSSRSHCVFTVDIL--KYNRSGITTQSSYKFCDLAGSERVNNTGT 392
            .::|::||:..::|||.:|.||||||.:||:.:|  |.....:|..|....||||||||. ....
Zfish   361 WKVLKVGQRNQSFASTHLNHNSSRSHSIFTIRVLHVKPQLGQVTRISELSVCDLAGSERC-KAQQ 424

  Fly   393 SGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNAD--IIPYRDSKLTMLLQAALLGKEKLAMIVT 455
            :|.|:|||.||||||:.||||:.|....|..|:..  ::|:||||||.:||:...|..:..|:|.
Zfish   425 NGERMKEANNINTSLLTLGRCITALRHNQTNKSRPPVVVPFRDSKLTRVLQSFFCGHGRSCMVVN 489

  Fly   456 VTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSY--------------CGFMEFSKMSTCE 506
            :.|....|:|.|..|.|::||..:: ..|..|. ||:|              ...:|..:..:.|
Zfish   490 INPCASTYDETLQALKFSAIATQLV-HGPCSKT-RVAYILSLLREQPTHPNDTTLLEEDEEESDE 552

  Fly   507 GGDYTKELEDENVRLQLEIEQLKYDHVLQMQ---LLEEKLRRELTATYQEIIQNNKKQYED--EC 566
            .||.|  :.|....|: .|:.||.:.:.|.|   .||.|:|.|:.....|:|...:..:.:  |.
Zfish   553 EGDIT--MFDPEALLK-AIDVLKREVLRQRQEKEELEAKVREEVCTEMMEVISRMQDDFSETLES 614

  Fly   567 EKKLLIAQRESEF--MLSSQRRRYEEQIEDLKDEIEELKNPASDTDISDDPNESKSPIEI---LD 626
            |:.|:..:.|::.  :.||.::.|.:::|:..|||.||.....:.:..     :.:|..|   |:
Zfish   615 ERDLMEKRCENKINNLKSSLKKYYSQELEERDDEIRELTAALKEKEAG-----NTAPAAIFPPLN 674

  Fly   627 DD 628
            ||
Zfish   675 DD 676

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 148/440 (34%)
Kinesin 93..479 CDD:278646 145/438 (33%)
GBP_C <512..603 CDD:303769 27/98 (28%)
coiled coil 576..586 CDD:293879 3/12 (25%)
coiled coil 592..603 CDD:293879 6/11 (55%)
kif20aNP_001154942.1 Motor_domain 77..510 CDD:277568 147/442 (33%)
Kinesin 84..510 CDD:278646 144/435 (33%)
TMPIT 572..>661 CDD:285135 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 231 1.000 Inparanoid score I3349
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 1 1.000 FOG0004952
OrthoInspector 1 1.000 T597232
orthoMCL 1 0.900 OOG5_136001
Panther 1 1.100 O PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R641
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.