DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and nod

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001285129.1 Gene:nod FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster

Alignment Length:497 Identity:114/498 (23%)
Similarity:191/498 (38%) Gaps:134/498 (27%)


  Fly   120 DSTSNNVNRMEKHFGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGSGKTYTL-- 179
            |..|..|::.|.||...  |.:|:.|.::|...:.|   |::|....|.:.||.:|:||:|::  
  Fly    37 DGKSLIVDQNEFHFDHA--FPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGM 99

  Fly   180 --LGDDV--RAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCP 240
              .|:.:  ..||:||||.:||                                          .
  Fly   100 TPPGEILPEHLGILPRALGDIF------------------------------------------E 122

  Fly   241 DISAHHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLK 305
            .::|..:..|..|.                |:.||:|||||..:|||...|           ::.
  Fly   123 RVTARQENNKDAIQ----------------VYASFIEIYNEKPFDLLGSTP-----------HMP 160

  Fly   306 IVGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGI 370
            :|..:    .:..|.:.:.|..:...:|.||.:......|::|:||||||.:.|:.:     ...
  Fly   161 MVAAR----CQRCTCLPLHSQADLHHILELGTRNRRVRPTNMNSNSSRSHAIVTIHV-----KSK 216

  Fly   371 TTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGR---CLDAASTVQKKKNADIIPYR 432
            |..|.....||||||.|..||..|:..:|..|||..|:.:.:   .:.|..||        ||||
  Fly   217 THHSRMNIVDLAGSEGVRRTGHEGVARQEGVNINLGLLSINKVVMSMAAGHTV--------IPYR 273

  Fly   433 DSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFM 497
            ||.||.:|||:|..:..|..:..::|......|.|:.|.|.:.||.:                  
  Fly   274 DSVLTTVLQASLTAQSYLTFLACISPHQCDLSETLSTLRFGTSAKKL------------------ 320

  Fly   498 EFSKMSTCEGGDYTKELEDENVRLQLEIEQLKYDHVLQMQLLEEKLRRELTATYQEIIQNNKKQY 562
                           .|....|..|.:....:..||.:..|......:...|.:..|:. .|.:|
  Fly   321 ---------------RLNPMQVARQKQSLAARTTHVFRQALCTSTAIKSNAANHNSIVV-PKSKY 369

  Fly   563 EDECEKKLLIAQRESEFMLSSQRRRYEEQIEDLKDEIEELKN 604
            ........::.:..||..::.:.::...::.:|::...||.:
  Fly   370 STTKPLSAVLHRTRSELGMTPKAKKRARELLELEETTLELSS 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 98/369 (27%)
Kinesin 93..479 CDD:278646 99/371 (27%)
GBP_C <512..603 CDD:303769 15/91 (16%)
coiled coil 576..586 CDD:293879 2/10 (20%)
coiled coil 592..603 CDD:293879 3/11 (27%)
nodNP_001285129.1 KISc 8..325 CDD:214526 100/409 (24%)
KISc 8..318 CDD:276812 98/369 (27%)
ComEA 540..648 CDD:224472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122341007
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.