DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Klp10A

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001285109.1 Gene:Klp10A FlyBaseID:FBgn0030268 Length:805 Species:Drosophila melanogaster

Alignment Length:677 Identity:158/678 (23%)
Similarity:247/678 (36%) Gaps:207/678 (31%)


  Fly     2 DSKEVSEVPRREVRSFLMARDPSIDRRFRPRPNKKMRLFDNIQESEEESFSEYSDTESEYKYQSS 66
            :.:...:...:|.:..||.:||.       .||     ::..|...|              |||:
  Fly   224 EKRRARQAEMKEEKVALMNQDPG-------NPN-----WETAQMIRE--------------YQST 262

  Fly    67 ----EATEGASCATSAADSSNVETGPQVFLRLRPVKDASKAYIVSEEANVLIT-----------S 116
                ...:|     .|.|...:    .|.:|.||:   |:..:..:|.:|:..           .
  Fly   263 LEFVPLLDG-----QAVDDHQI----TVCVRKRPI---SRKEVNRKEIDVISVPRKDMLIVHEPR 315

  Fly   117 CKVDSTSNNVNRMEKH-FGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGSGKTY 177
            .|||.|    ..:|.| |.|...|:.|.....:|.....|   .|.|....|...||.:|||||:
  Fly   316 SKVDLT----KFLENHKFRFDYAFNDTCDNAMVYKYTAKPLVKTIFEGGMATCFAYGQTGSGKTH 376

  Fly   178 TLLGD------DVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLL 236
            |:.|:      |.:.||...|.:::|     .....|:.:.:|                      
  Fly   377 TMGGEFNGKVQDCKNGIYAMAAKDVF-----VTLNMPRYRAMN---------------------- 414

  Fly   237 DLCPDISAHHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPR 301
                                            ::|..||.|||:..|:|||:     ||      
  Fly   415 --------------------------------LVVSASFFEIYSGKVFDLLS-----DK------ 436

  Fly   302 KNLKIV-GNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKY 365
            :.|::: ..|..|.:.|||...|...||.|:|::.|....|...||.|:||||||.||.:.:...
  Fly   437 QKLRVLEDGKQQVQVVGLTEKVVDGVEEVLKLIQHGNAARTSGQTSANSNSSRSHAVFQIVLRPQ 501

  Fly   366 NRSGITTQSSYKFCDLAGSERVNNTGTSGLRLK-EAKNINTSLMVLGRCLDAASTVQKKKNADII 429
            ..:.|  ...:.|.||||:||..:|.::..:.: |...||.||:.|..|:.|..     |.:..:
  Fly   502 GSTKI--HGKFSFIDLAGNERGVDTSSADRQTRMEGAEINKSLLALKECIRALG-----KQSAHL 559

  Fly   430 PYRDSKLTMLLQAALLG-KEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSY 493
            |:|.||||.:|:.:.:| |.|..||..::|.....|..||.|.:|...|.::.|:.|        
  Fly   560 PFRVSKLTQVLRDSFIGEKSKTCMIAMISPGLSSCEHTLNTLRYADRVKELVVKDIV-------- 616

  Fly   494 CGFMEFSKMSTCEGGDYTKELE---DENVRLQLEIEQLKYDHVLQMQL-------LEEKLRRELT 548
                     ..|.||| |:.:|   ||      |.|:|...|....||       ..:...:...
  Fly   617 ---------EVCPGGD-TEPIEITDDE------EEEELNMVHPHSHQLHPNSHAPASQSNNQRAP 665

  Fly   549 ATYQE--IIQNNKKQ------------------YEDECEKKLLIAQ------RESEFMLSSQRRR 587
            |::..  :|.||...                  .|.|...:|::..      :::|.|:....|.
  Fly   666 ASHHSGAVIHNNNNNNNKNGNAGNMDLAMLSSLSEHEMSDELIVQHQAIDDLQQTEEMVVEYHRT 730

  Fly   588 YEEQIEDLKDEIEELKNPASDTDISDD 614
            ....:|....|.:.|.|..:..|...|
  Fly   731 VNATLETFLAESKALYNLTNYVDYDQD 757

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 110/412 (27%)
Kinesin 93..479 CDD:278646 110/410 (27%)
GBP_C <512..603 CDD:303769 22/127 (17%)
coiled coil 576..586 CDD:293879 2/10 (20%)
coiled coil 592..603 CDD:293879 3/11 (27%)
Klp10ANP_001285109.1 KISc_KIF2_like 278..608 CDD:276818 110/418 (26%)
Kinesin 284..609 CDD:278646 110/409 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122349043
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.