DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sub and Klp10A

DIOPT Version :10

Sequence 1:NP_611260.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_572687.1 Gene:Klp10A / 32049 FlyBaseID:FBgn0030268 Length:805 Species:Drosophila melanogaster


Alignment Length:72 Identity:19/72 - (26%)
Similarity:28/72 - (38%) Gaps:16/72 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SLAKFQNLKEIGLDK------PLIFSSETPLRKFVA---------YIDPENNFAIEDKL-SQVNT 189
            ::.|.|.::.:..||      |.....:.|..|..:         .|.||....||.:| |....
  Fly    63 TIPKQQAIEPVEKDKENFHESPRQSRQQKPASKIASAREVIKRDGVIPPEALTIIEQRLRSDPMF 127

  Fly   190 LQQIENV 196
            .|||:||
  Fly   128 RQQIDNV 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
subNP_611260.1 KISc 89..477 CDD:276812 19/72 (26%)
GBP_C <512..603 CDD:293879
coiled coil 576..586 CDD:293879
coiled coil 592..603 CDD:293879
Klp10ANP_572687.1 KISc_KIF2_like 278..608 CDD:276818
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.