DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Kif23

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001101625.1 Gene:Kif23 RGDID:1308596 Length:952 Species:Rattus norvegicus

Alignment Length:615 Identity:167/616 (27%)
Similarity:277/616 (45%) Gaps:116/616 (19%)


  Fly    82 SNVETGPQVFLRLRPVK--DASKAYIVSEEANVLITSCKVDSTSNNVNRMEKHFGFTSIFDSTVG 144
            :|::....|:.|:||:.  |......|.....|.:.:.:....:.|.:..|..:.|..:|.:...
  Rat    20 TNLKDPVGVYCRVRPLSFPDQECCVEVVNSTTVQLHTPEGYRLNRNGDYKETQYSFKRVFGTHTT 84

  Fly   145 QRDIYDTCVGPKIMEEECV-----TIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTV 204
            |::::|....|.:  ::.:     .:.|||.:|||||||:.|.....|::||.|..||.....  
  Rat    85 QKELFDVVASPLV--DDLIHGKNGLLFTYGVTGSGKTYTMTGSPGSGGLLPRCLNMIFNSIGS-- 145

  Fly   205 FRSPKLKLINGSIVFLQDDASLKELQI---------RKKLLDLCPDISAHHQRLKQVIDGDHMFE 260
            |::.:       .||..:|.:..|:|.         :::.:.:....|:..|...:..|..::.|
  Rat   146 FQAKR-------FVFKSNDRNSMEIQCEVDALLERQKREAMPIPKTPSSKRQADPEFADMINVQE 203

  Fly   261 TKASTDV---SVL-VWVSFVEIYNELVYDLL------AIPPKQDKLGEVPRKNLKIVGNKGHVFI 315
            ...:.:|   ||. |:||::||||..:||||      .|.||      :|:..:.......::::
  Rat   204 FCKAEEVDEDSVYGVFVSYIEIYNNYLYDLLEEVQFDPIKPK------LPQSKMLREDKNHNMYV 262

  Fly   316 KGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILK-----------YNRSG 369
            .|.|.|.|.|:|||..:...||::...|:|.:|..|||||.||::.:::           ..:..
  Rat   263 AGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFSIKLVQAPLDADGDNVLQEKEQ 327

  Fly   370 ITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDS 434
            ||. |.....|||||||.|.|...|.||:||.|||.|||.|..|::.....|......::|||||
  Rat   328 ITI-SQLSLVDLAGSERTNRTKAEGNRLREAGNINQSLMTLRTCMEVLRENQMYGTNKMVPYRDS 391

  Fly   435 KLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCG---- 495
            |||.|.:....|:.|:.|||.|.|..:.|||:|.|:.||.:.:.:....||.|    :.||    
  Rat   392 KLTHLFKNYFDGEGKVRMIVCVNPKAEDYEESLQVMRFAEVTQEVEVARPVDK----AICGLTPG 452

  Fly   496 ---------------------FMEFSKMSTCEGGDYTKELEDENVRLQLEIEQLKYDHVLQMQLL 539
                                 ...|..:..|:    ..::.||....:| ::.|:..|.|: ||:
  Rat   453 RRYRNLPRAGPVGDEPLTEEILQSFPPLPPCK----LLDVNDEETLPRL-MDALEKRHRLR-QLM 511

  Fly   540 EEKLRRE---LTATYQEIIQ--NNKKQYEDE--CEKKLLIAQRESEF---------------MLS 582
            .|:|.::   ..|.::|...  :||:.|..|  .||:.:|:.::||.               :|.
  Rat   512 TEELNKQCVAFKALFKEFDNSLSNKENYIQEKLNEKEKVISGQKSEIERLEKKNKTLEYKIEILE 576

  Fly   583 SQRRRYEEQIEDLKDEIE----ELKNPASD 608
            .....|||...:|:.|:|    :|:...||
  Rat   577 KTTTIYEEDKRNLQQELESQHQKLQREFSD 606

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 128/425 (30%)
Kinesin 93..479 CDD:278646 127/423 (30%)
GBP_C <512..603 CDD:303769 29/117 (25%)
coiled coil 576..586 CDD:293879 3/25 (12%)
coiled coil 592..603 CDD:293879 4/15 (27%)
Kif23NP_001101625.1 KISc_KIF23_like 24..434 CDD:276819 128/428 (30%)
Kinesin 31..436 CDD:278646 127/423 (30%)
BAR <483..621 CDD:299863 32/131 (24%)
MKLP1_Arf_bdg 796..895 CDD:293148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.